JURNAL SISTEM INFORMASI

informasi dan komunikasi, terutama pada konsep sistem informasi geografis, ... makalah yang mengangkat perihal Sistem Informasi dan Teknologi Informas...

102 downloads 1983 Views 4MB Size
JURNAL SISTEM INFORMASI Fakultas Sains dan Teknologi UIN Syarif Hidayatullah - Jakarta Vol. 8 No. 2, Oktober 2015

ISSN: 1979 – 0767 Penanggung Jawab Dekan Fakultas Sains dan Teknologi Dr. Agus Salim, M.Si Pimpinan Redaksi (Editor in Chief) Zainul Arham, S.Kom.,M.Si. Dewan Redaksi (Editor Board) Ditdit N. Utama, MM, M.Com Ir. Bakri La Katjong, MT Bayu Waspodo, MM Ir. M. Qomarul Huda, M.Kom Nur Aeni Hidayah, MMSI Zulfiandri, MMSI Penelaah Senior (Senior Reviewer) Dr. Syopiansyah Jaya Putra, M.Sis Aries Susanto HT, Ph.D Husni Teja Sukmana, Ph.D Mitra Bestari Dr. Eko Syamsuddin Hasrito Prof. Dr. Ir. I Nengah Surati Jaya Dr.Ir. Taslim Rochmadi, M.Sc Dr.Ir. Rusdianto Roestam, M.Sc Penyunting Pelaksana Qurrotul Aini, MT Nia Kumaladewi, MMSI Penyunting Pengelola Nur Aeni Hidayah, MMSI

Koordinator Sekretariat dan Pelaksana Tata Usaha Fitroh, MMSI Eva Khudzaeva, M.Si

Alamat Penerbit / Redaksi Program Studi Sistem Informasi Fakultas Sains dan Teknologi UIN Syarif Hidayatullah Jl. Ir. H. Djuanda No. 95, Ciputat 15412 Telp / Fax. (021) 7493545 / (021) 7493315 Website: http://fst.uinjkt.ac.id E-mail: [email protected] dan [email protected] Jurnal Sistem Informasi merupakan jurnal keilmuan bidang sistem informasi dan teknologi informasi yang memuat tulisan-tulisan ilmiah mengenai penelitian-penelitian murni dan terapan serta ulasan-ulasan umum tentang perkembangan teori, metode dan ilmu-ilmu terapan terkait. Jurnal Sistem Informasi diterbitkan oleh Program Studi Sistem Informasi. Redaksi mengundang para peneliti, praktisi dan mahasiswa untuk menulis perkembangan ilmu di bidang yang berkaitan dengan sistem informasi dan teknologi informasi. Jurnal Sistem Informasi diterbitkan 2 (dua) kali dalam 1 tahun pada bulan Februari dan Oktober.

KATA PENGANTAR

Segala puji dan syukur kehadirat Allah SWT atas rahmat-Nya sehingga Jurnal Sistem Informasi Volume 8 No.2 bulan Oktober 2015 dapat terbit. Keberadaan Sistem Informasi dan Teknologi Informasi mencakup berbagai aspek kehidupan, dalam hal ini jurnal Sistem Informasi Fakultas Sains dan Teknologi Universitas Islam Negeri Syarif Hidayatullah Jakarta hadir untuk memenuhi kebutuhan masyarakat khususnya para akademisi dan praktisi teknologi informasi dan komunikasi, terutama pada konsep sistem informasi geografis, sistem informasi korporat dan sistem informasi bisnis syari’ah. Dengan terbitnya Jurnal Sistem Informasi ini diharapkan memberikan kontribusi yang besar terhadap perkembangan dalam konsep dan aplikasi sistem informasi dan teknologi informasi serta meningkatnya wawasan dan kemampuan para akademisi dan praktisi teknologi informasi dan komunikasi. Edisi Jurnal Kali Ini memuat 8 (Delapan) makalah yang mengangkat perihal Sistem Informasi dan Teknologi Informasi, yaitu: Rancang Bangun Sistem Informasi Pelayanan Haji Dan Umroh Berbasis Web (Studi Kasus: KBIH AlKarimiyah Depok); Rancangan Sistem Informasi Administrasi Rekening Tabungan Pada Baitul Maal Wat Tamwil Usaha Mulya; Rancang Bangun Sistem Penggajian Guru Menggunakan Akad Ijarah Pada SMK Salafiyah Syafi’iyyah; Rancang Bangun Sistem Informasi Pengendalian Persediaan Bahan Baku Dan Hasil Produksi Pada PT Gemilang Sinergitama Mandiri; Analisa Dan Perancangan Sistem Informasi Inventori Produk Non-BBM PT. Pertamina (Persero); Analisis Dan Perancangan Sistem Informasi Rawat Inap (Studi Kasus :Rumah Sakit Ibu Dan Anak Buah Hati Ciputat); Analisa Dan Desain Sistem Kehadiran Pegawai Pada Pusat Penelitian Perkembangan IPTEK Lembaga Ilmu Pengetahuan Indonesia; Sistem Informasi Pelayanan Izin Mendirikan Bangunan Dan Peruntukan Penggunaan Tanah Pada Badan Penanaman Modal Dan Pelayanan Perizinan Kabupaten Sumedang. Kami selaku tim redaksi mengucapkan terima kasih kepada semua pihak yang telah memungkinkan terbitnya Jurnal Sistem Informasi ini. Kami berharap jurnal sistem informasi ini dapat menjadi salah satu alternatif pilihan bacaan yang berguna, informatif dan inovatif.

Jakarta, Oktober 2015 Hormat Kami

Tim Redaksi Jurnal SI

ii

JURNAL SISTEM INFORMASI

Fakultas Sains dan Teknologi UIN Syarif Hidayatullah - Jakarta

Oktober 2015

Vol. 8 No. 2

DAFTAR ISI KATA PENGANTAR DAFTAR ISI

iii v

RANCANG BANGUN SISTEM INFORMASI PELAYANAN HAJI DAN UMROH BERBASIS WEB (STUDI KASUS: KBIH AL- KARIMIYAH DEPOK) Nur Aeni hidyah, Meinarini Catur Utami, Apris Tri Suhendar

1

RANCANGAN SISTEM INFORMASI ADMINISTRASI REKENING TABUNGAN PADA BAITUL MAAL WAT TAMWIL USAHA MULYA Yasin Efendi, Saipul Anwaro, Anung Y Sumantri , Amin Fauzi ……………………………………………………..

8

RANCANG BANGUN SISTEM PENGGAJIAN GURU MENGGUNAKAN AKAD IJARAH PADA SMK SALAFIYAH SYAFI’IYYAH Yuni Sugiarti, Abdul Wadud dan Sigit Apriyanto

18

RANCANG BANGUN SISTEM INFORMASI PENGENDALIAN PERSEDIAAN BAHAN BAKU DAN HASIL PRODUKSI PADA PT GEMILANG SINERGITAMA MANDIRI Nia Kumaladewi, Meinarini Catur Utami, Iskandar Arrosyid ………………………………………………………

27

ANALISA DAN PERANCANGAN SISTEM INFORMASI INVENTORI PRODUK NON-BBM PT. PERTAMINA (PERSERO) Gladly C. Rorimpandey

37

ANALISIS DAN PERANCANGAN SISTEM INFORMASI RAWAT INAP (STUDI KASUS :RUMAH SAKIT IBU DAN ANAK BUAH HATI CIPUTAT) Yuni Sugiarti, Nuryasin, Nur Fitriani ………………………………………………………………………...

47

ANALISA DAN DESAIN SISTEM KEHADIRAN PEGAWAI PADA PUSAT PENELITIAN PERKEMBANGAN IPTEK LEMBAGA ILMU PENGETAHUAN INDONESIA Warkim, Hafiz Novanda Ichwan, Husnul Kamal Z …………………………………………………………………………

53

SISTEM INFORMASI PELAYANAN IZIN MENDIRIKAN BANGUNAN DAN PERUNTUKAN PENGGUNAAN TANAH PADA BADAN PENANAMAN MODAL DAN PELAYANAN PERIZINAN KABUPATEN SUMEDANG Bayu Waspodo, Ahmad Nurul Fajar, Noor Hadi Prayitno

63

iii

Rancang Bangun Sistem Informasi Pelayanan Haji dan Umroh Berbasis Web (Studi Kasus: KBIH Al- Karimiyah Depok) Nur Aeni Hidayah1, Meinarini Catur Utami2, Apris Tri Suhendar3 Program Studi Sistem Informasi, Fakultas Sains dan Teknologi, Universitas Islam Negeri Syarif Hidayatullah Jl. Ir. H. Juanda No. 95, Ciputat 15412 Jakarta E-mail : [email protected], [email protected] Abstract - KBIH Al Karimiyah is an management institution of the pilgrims and Umrah. One of the services provided by KBIH Al Karimiyah is guidance services for the Hajj and Umrah pilgrims. Registration systems and services on KBIH Al Karimiyah nowaday, all the process is manually, All of them did by the hand writing on the registration books worshipers, then inputted back into the computer using Microsoft Excel. To provide the best service to the congregation, then the information system made Hajj and Umrah services with a web-based Systems Development Method RAD (Rapid Application Development) with tools UML (Unified Modeling Language) using usecase diagrams include diagrams, activity diagrams, class diagrams, sequence diagrams up to the stage of testing using blackbox testing tested for part pilgrims, pilgrims, and database admin, chairman, finance, front office and head of the secretariat of the overall results of the test in accordance with the expected design. This research resulted in a system of Hajj and Umrah services information web-based functions to support the course of the registration process of pilgrims, setting guidance schedule, schedule health checks and taking the green book for the pilgrimage, schedules and decision-making passport passport book, the financial statements for the chairman and their chat mini order. It can maintained the connection of KBIH fellow members, data, and other information related to Hajj and Umrah in KBIH Al Karimiyah. Keyword: KBIH Al- Karimiyah, Information System Service Hajj and Umrah, RAD, UML, PHP, MySQL.

I.

PENDAHULUAN

A. Latar Belakang Seiring perkembangan komunikasi yang sangat pesat, sampai saat ini internet telah banyak dibahas bahkan digunakan oleh berbagai perusahaan, organisasi, bahkan perorangan. Sudah makin banyak perusahaan, organisasi, dan perseorangan tergabung dalam jaringan internet, sehingga membangkitkan minat bagi perusahaan, organisasi lainnya yang ikut bergabung. Internet telah menjadi sarana komunikasi paling efisien dan efektif. Internet merupakan suatu media komunikasi dan informasi yang memiliki berbagai keunggulan dan kelebihan dibandingkan dengan media komunikasi lainnya. Dengan internet kita dapat berhubungan dengan pengguna internet lain diberbagai tempat yang berbeda dan mendapatkan informasi yang kita butuhkan dengan cepat dan akurat. KBIH Al-Karimiyah Depok adalah lembaga yang bergerak dalam bidang kepengurusan para calon jamaah haji dan umroh yang bersifat kelompok. Sistem pelayanan yang diberikan oleh KBIH AlKarimiyah Depok saat ini adalah pelayanan pendaftaran calon jamaah umroh dan haji, pengecekan jadwal bimbingan, kepengurusan passport ke kantor imigrasi, proses pembayaran dan laporan keuangan. Untuk mengatasi permasalahan tersebut yang masih manual maka diperlukan pembuatan sistem yang

terkomputerisasi guna memudahkan staf untuk mengelola data calon jamaah, tersebarnya informasi untuk para calon jamaah dan melancarkan kegiatan operasional di lembaga tersebut. Selama ini KBIH Al-Karimiyah masih dalam tahap pembangunan sistem yang semuanya manual dilakukan oleh para stafnya begitu pula pemasarannya sehingga banyak orang yang tidak tahu akan keberadaan KBIH Al-Karimiyah ini. Dengan adanya sistem online ini bisa membantu segala keperluan yang dibutuhkan stafnya dan dapat mengelola data calon jamaah dengan cepat dan akurat begitu juga para jamaahnya. Dan sistem pendaftaran pada KBIH Al-Karimiyah ini masih tergolong cukup sederhana yaitu dengan mengambil formulir pendaftaran di kantor KBIH Al-Karimiyah secara langsung oleh calon jamaah yang berminat mendaftar dan mengembalikan formulir pendaftaran yang telah diisi ke kantor KBIH Al-Karimiyah. Apabila jamaah telah terdaftar sebagai anggota pada KBIH Al-Karimiyah, maka mereka harus aktif mencari informasi tentang kegiatan bimbingan pada papan pengumuman di kantor KBIH Al-Karimiyah yang sudah pasti memakan waktu, tenaga dan biaya bagi jamaah tersebut. Berkaitan dengan hal tersebut, maka peneliti bermaksud untuk menerapkan teknologi internet kepada sebuah lembaga kecil yang mengelola menyelenggarakan keberangkatan haji dan umroh. Oleh sebab itu perlu adanya perbaikan sistem agar 1

pelaksanaan pendaftaran serta informasi-informasi lainnya pada lembaga KBIH Al-Karimiyah ini dapat dilakukan secara online sehingga informasi-informasi mengenai KBIH Al-Karimiyah ini dapat diketahui oleh para calon pendaftar, pendaftaran pun dapat dilakukan tanpa harus datang langsung ke kantor KBIH Al-Karimiyah dan pengelolaan data-data jamaah pun bisa dikelolah dengan cepat dan akurat oleh para stafnya. Sehingga tidak banyak waktu juga yang terbuang untuk melakukan pendaftaran yang biasanya memerlukan waktu kurang lebih 3 hari sebelum adanya pelayanan online. Selain proses pendaftaran yang cukup memakan waktu, pendaftaran haji dan umroh memerlukan banyak dokumen-dokumen yang harus dilengkapi oleh jamaah yang ingin menunaikan ibadah haji dan umroh tersebut apabila calon jamaah tersebut lupa akan membawa kelengkapan dokumen-dokumen tersebut maka calon jamaah harus kembali ke kantor di lain waktu. Sehingga membutuhkan waktu yang lama hanya untuk mengurus proses pendaftarnnya. Karena proses dan dokumen yang harus dilengkapi cukup banyak dan juga laporan keuangan yang dibutuhkan oleh ketuanya, maka penulis memberikan solusi kepada KBIH Al-Karimiyah untuk mengatasi masalah yang dihadapi terhadap calon jamaahnya dan juga memberikan kemudahan kepada staf dan para calon jamaah untuk mengurus semuanya dengan memberikan jasa pelayanan dan bimbingan haji dan umroh selama jamaah masih berada di tanah air sampai jamaah tiba di tanah suci. Dengan mendaftarkan diri ke KBIH Al-Karimiyah, jamaah tidak perlu kesulitan lagi mencari waktu dalam mengurus dokumen-dokumen persyaratan keberangkatan haji dan umroh. Maka dari itu, penulis mengajukan sebuah penelitian yang berjudul “RANCANG BANGUN SISTEM INFORMASI PELAYANAN HAJI DAN UMROH BERBASIS WEB” (Studi Kasus: KBIH AL-KARIMIYAH DEPOK). B. Rumusan Masalah Identifikasi masalah yang ada di KBIH Al – Karimiyah Depok, yakni : 1. Proses antrian yang berkepanjangan dapat menyebabkan menumpuknya para calon jamaah yang ingin melakukan pendaftaran. Hal tersebut menimbulkan kurang efisiennya waktu. 2. Pencatatan data secara manual memungkinkan terjadinya kehilangan atau kesalahan dalam pencatatan data. 3. Laporan yang disajikan tidak terintegrasi sehingga pada saat pencarian data jamaah harus dicari secara manual dan hal tersebut memakan waktu yang cukup lama. Berdasarkan permasalahan diatas, maka dapat dirumuskan suatu permasalahan yang utama, yaitu : Bagaimana merancang dan membangun sistem 2

informasi yang dapat memberikan kemudahan bagi KBIH Al-Karimiyah Depok untuk mengelola data jamaah, memberikan kemudahan untuk calon jamaah dalam proses pendaftaran dan informasi-informasi yang harus diketahui oleh jamaah yang sudah terdaftar serta menyajikan laporan keuangan yang dibutuhkan ketua KBIH Al-Karimiyah Depok? C. Batasan Masalah Batasan dari penelitian ini adalah sebagai berikut : 1. Penelitian ini dilakukan di kantor KBIH AlKarimiyah Depok. 2. Sistem pelayanan haji dan umroh ini menyediakan pendaftaran haji dan umroh, memberikan informasi mengenai jadwal bimbingan, jadwal dan informasi cek kesehatan untuk ke dinas kesehatan dan pengambilan buku hijau untuk yang haji saja, jadwal dan informasi pembuatan passport untuk ke kantor imigrasi dan pengambilan buku passport, pembayaran bimbingan haji dan umroh dan laporan data jamaah, laporan data pembayaran bimbingan dan laporan keuangan serta adanya chat mini antar jamaah agar selalu terjaga silaturahminya. 3. Peneliti menggunakan Rapid Application Development (RAD) sebagai metodologi penelitiannya dari tahap perencanaan hingga tahap pengujian dan Unified Modelling Language (UML) sebagai tools. 4. Peneliti membuat aplikasi dengan menggunakan bahasa pemrograman PHP yang dikoneksikan dengan database MySQL dengan rancangan antar muka Macromedia Dreamweaver. 5. Peneliti membuat sistem informasi berbasis web yang dapat diakses oleh staf KBIH AlKarimiyah, jamaah dan ketua KBIH AlKarimiyah sebagai administrator yang memiliki hak akses tertinggi. D. Tujuan Penelitian Untuk merancang dan membangun sistem informasi yang dapat memberikan kemudahan bagi KBIH Al-Karimiyah Depok untuk mengelola data jamaah, proses pendaftaran tidak memakan waktu yang terlalu lama dan menyajikan laporan data jamaah, laporan data pembayaran jamaah serta laporan keuangan yang dibutuhkan ketua KBIH AlKarimiyah Depok serta memberikan hubungan silaturahmi dengan jamaah lain agar tetap terjaga yaitu dengan adanya sebuah chat mini.

II. LANDASAN TEORI A. Konsep Dasar Sistem Rancang Bangun Perancangan/rancang merupakan serangkaian prosedur untuk menerjemahkan hasil analisa dan sebuah sistem ke dalam bahasa pemrograman untuk mendeskripsikan dengan detail bagaimana komponenkomponen sistem diimplementasikan. Sedangkan pengertian pembangunan/bangun sistem adalah kegiatan menciptakan sistem baru maupun mengganti atau memperbaiki sistem yang telah ada baik secara keseluruhan maupun sebagian [1]. B. Pelayanan Pelayanan adalah setiap tindakan atau kegiatan yang dapat ditawarkan oleh suatu pihak kepada pihak lain, yang pada dasarnya tidak berwujud dan tidak mengakibatkan kepemilikan apapun [2]. C. Haji Haji adalah rukun Islam kelima, dimana merupakan kewajiban sekali seumur hidup bagi setiap orang Islam yang mampu menunaikannya. Secara bahasa, haji berarti Al-Qashd (bermaksud) adalah pergi mengunjungi tempat yang diagungkan. Sementara secara istilah, haji bermaksud mendatangi Baitullah untuk amal ibadah tertentu yang dilakukan pada waktu dan cara yang tertentu juga [3]. D. Umroh Pada pasal 1 angka 16 Undang-Undang Nomor 13 Tahun 2008 tentang Penyelenggaraan Ibadah Haji menyebutkan mengenai definisi ibadah umroh, yaitu sebagai berikut: ibadah umroh adalah umroh yang dilaksanakan diluar musim haji. Ibadah umroh tersebut dilaksanakan dan diselenggarakan oleh biro perjalanan wisata yang telah mendapat izin sebagai penyelenggara perjalanan ibadah umroh atau disebut dengan PPIU sesuai dengan pasal 35 ayat (1) Keputusan Menteri Agama Republik Indonesia Nomor 396 tahun 2003 tentang Perubahan Atas Keputusan Menteri Agama Republik Indonesia Nomor 371 Tahun 2002 tentang Penyelenggaraan Ibadah Haji dan Umroh [3]. E. Website Website dapat dibagi menjadi 2 kategori, yaitu website statis dan website dinamis [4]: 1. Website Statis Website statis dibentuk dengan menggunakan HTML saja. 2. Web Dinamis Web dinamis terkadang diartikan sebagai halaman yang dilengkapi dengan animasi gambar, selain dapat berinteraksi dengan basis data.

F. UML (Unified Modelling Language) UML merupakan kesatuan dari bahasa pemodelan yang dikembangkan oleh Booch. Object Modeling Technique (OMT) dan Object Oriented Software Engineering (OOSE). Metode Booch dari Grady Booch sangat terkenal dengan nama metode Design Object Oriented. Metode ini menjadikan proses analisis dan design ke dalam empat tahapan iteratif, yaitu identifikasi kelas-kelas dan obyekobyek, identifikasi simentik dari hubungan obyek dan kelas tersebut, perincian interface dan implementasi [5]. G. RAD (Rapid Application Development) Rapid Application Development (RAD) adalah suatu pendekatan berorientasi objek terhadap pengembangan sistem yang mencakup suatu metode pengembangan serta perangkat-perangkat lunak. Terdapat tiga fase dalam RAD, yaitu requirement planning, workshop design, dan implementation [6]. III. METODE PENELITIAN A. Metode Pengumpulan Data Dalam mengumpulkan data untuk pengembangan sistem ini dilakukan dengan cara : 1. Observasi 2. Wawancara 3. Studi Pustaka 4. Studi Literatur B. Metode Pembuatan Sistem Tahap-tahap pembuatan yang dilakukan, yaitu: 1. Perencanaan syarat 2. Workshop Design, meliputi usecase diagram, usecase scenario, activity diagram, sequence diagram, class diagram 3. Implementasi Sistem (System Implementation) C. Kerangka Penelitian Dalam melakukan penelitian ini, peneliti melakukan tahapan-tahapan kegiatan dengan mengikuti rencana kegiatan yang tertuang dalam kerangka penelitian meliputi metode pengumpulan data dan metode pengembangan sistem. Berikut ini dapat dilihat gambaran kerangka berpikir penelitian.

3

B. Sistem Usulan Setelah melihat data maupun informasi yang dibutuhkan, peneliti melihat sistem yang berjalan pada KBIH Al-Karimiyah Depok memiliki kendala, yaitu dalam hal sistem pendaftaran, pencatatan data, pencarian data dan transaksi pembayaran yang diperlukan setiap periodenya. Selain itu juga penulis menambahkan adanya chat mini antar sesama jamah dalam anggota KBIH agar selalu tetap terjaga silaturahminya dan juga laporan data jamaah dan data pembayaran jamaah serta laporan keuangan per periode nya. KBIH Al-Karimiyah Depok juga memerlukan sebuah media informasi untuk mempermudah KBIH dalam mempromosikan layanan-layanan yang terdapat di KBIH Al-Karimiyah Depok. Dalam hal ini pengolahan data dan informasi jamaah sangat membutuhkan sebuah sistem yang dapat menjadi pemecah permasalahan serta dapat memudahkan para jamaah dan juga kinerja staf sehingga kegiatan dalam KBIH Al-Karimiyah Depok dapat berjalan efektif dan efisien.

Gambar 1. Kerangka Penelitian IV. HASIL DAN PEMBAHASAN A. Sistem Berjalan Analisis sistem berjalan dilakukan dari jamaah yang mengajukan pendaftaran keanggotaan baik haji maupun umroh dalam KBIH Al-Karimiyah, yaitu dimana jamaah sudah mendapat nomor porsi dan dokumen yang sudah divalidasi atau diberikan oleh DEPAG. Dokumen tersebut adalah berupa form yang berisi biodata lengkap jamaah yang telah disertai nomor SPPH (Surat Pernyataan Pergi Haji) dan nomor porsi jamaah tersebut. Dokumen tersebut hanya didapat oleh jamaah yang akan menunaikan ibadah haji, lain hal nya dengan umroh. Proses tersebut lebih lengkapnya dapat dilihat pada Gambar 2.

Gambar 2. Analisis Sistem Berjalan 4

Gambar 3. Analisis Sistem Usulan C. Usecase Diagram Pada tahap ini terdapat beberapa hal yang harus dikerjakan, yaitu : - Penentuan Aktor - Identifikasi Usecase Diagram,

System

Calon jamaah

Registrasi

Kepala sekretariat

Tabel 1. Narasi Usecase Login Use case Name Login

Logout Update data diri <>

Konfirmasi pembayaran

Use case ID

1

Actor

Jamaah, admin database, ketua KBIH, kepala sekretariat, keuangan, front office

Pre condition

Actor harus mengisi username dan password terlebih dahulu

Trigger

Actor dapat masuk dan mengakses sistem informasi pelayanan haji dan umroh online

Description

Usecase ini menggambarkan kegiatan actor untuk mengisi username dan password pada form login agar dapat masuk ke dalam sistem

Login

Jamaah Keuangan

Lihat jadwal bimbingan Chat mini <> Update username&password Lihat jadwal cek kesehatan <>

Validasi jamaah

<>

Lihat jadwal pembuatan passport

Front office

<> <>

Manajemen data jamaah

Validasi pembayaran

<>

Ketua KBIH Laporan data jamaah

Manajemen cek kesehatan Admin dan database Manajemen layanan bimbingan

Laporan data pembayaran <>

Manajemen pembayaran bimbingan

Manajemen user

Manajemen pembuatan passport

Layanan haji

Layanan umroh

Laporan keuangan per periode

Gambar 4. Usecase Diagram D. Narasi Usecase Diagram Usecase scenario merupakan penjelasan yang lebih terperinci mngenai masing-masing usecase yang terjadi di dalam sistem. Usecase diagram terdiri dari: - Nama usecase : Nama usecase yang akan dideskripsikan - Actor : Aktor yang terlibat - Trigger : Tujuan dari usecase - Pre condition : Syarat penting bagi usecase untuk memulai - Description : Mendeskripsikan actor dalam menjalankan sistem - Typical course of events : Kegiatan yang dilakukan oleh usecase - Alternate courses : Kegiatan alternatif lain saat sistem merespon - Conclusion : Kesimpulan dari kegiatan sistem - Post condition : Kegiatan setelah usecase selesai dikerjakan Contoh narasi usecase diagram login dapat dilihat pada tabel 1.

Typical course of events

Actor Action 1. Input username dan password 2. Pilih login

Alternate courses

System response

3. Verifikasi username dan password

4. Menampilkan halaman utama 1. Jika username dan password benar maka actor akan masuk ke dalam sistem, sedangkan jika salah maka actor harus input username dan password kembali

Conclusion

Actor berhasil masuk ke dalam sistem informasi pelayanan haji dan umroh online

Post condition

Menampilkan halaman utama dalam sistem

E. Activity Diagram Activity diagram menggambarkan alur kerja (work flow) sebuah urutan aktivitas pada suatu proses. Diagram ini sangat mirip dengan flowchart karena dengan activity diagram dapat memodelkan proses logika, proses bisnis dan alur kerja. Perbedaan utamanya adalah flowchart dibuat untuk menggambarkan alur kerja dari sebuah sistem, sedangkan activity diagram dibuat untuk menggambarkan aktivitas actor.

5

Calon Jamaah, admin dan databse

G. Sequence Diagram

Sistem

Buka halaman utama

Tampil halaman utama

mainUI

user

Jamaah

: Calon jamaah

Pilih menu layanan

1 : akses website()

Tampil sub menu layanan

2 : menampilkan halaman home()

Pilih sub menu haji atau umroh

3 : pilih menu layanan() Tampil menu persyaratan,fasilitas,pendaftaran,login haji/umroh

Pilih pendaftaran jamaah haji/umroh

4 : tampil sub menu layanan() Tampil form pendaftaran

5 : pilih pendaftaran jamaah haji/umroh()

Input form pendaftaran

6 : tampil form pendaftaran haji/umroh() Pilih Register

Data jamaah baru tersimpan

7 : input form pendaftaran haji/umroh()

Gambar 5. Activity Diagram

8 : simpan data diri jamaah() 9 : tampil data diri jamaah()

F. Class Diagram Class diagram menggambarkan kelas-kelas objek yang menyusun sebuah sistem dan juga menghubungkan antara kelas objek yang terjadi di dalam sistem informasi pelayanan haji dan umroh berbasis web.

DetailChat +idDetailchat +idChat +to +isi +waktu +status

Chat 1

*

+idChat +user1 +user2 +Create() +Read() +Delete()

* 1 UserType

*

1

+idUsertype +nama

1

User +idUser +username +password +email +idUsertype

DetailPasport +idDetailpassport +idPassport +no_ktp

Passport 1

*

CekKesehatan

Jamaah

+idPegawai +idUser +namalengkap +alamat

+idUser +no_ktp 1 +no_passport +namalengkap +ayah +tempat_lahir +tanggal_lahir +umur +jenis_kelamin +rambut +alis +hidung +muka +tinggi +berat_badan +pendidikan 1 +pekerjaan +warga_negara +alamat +kelurahan +kecamatan +kabupaten +propinsi +kode_pos +no_telp * +gol_darah +status +foto +pernah_haji_umroh +nama_mahram +hub_mahram

+Input() +Read() +Update() +Delete() +Search() +Cetak()

*

*

+idCekkesehatan +jenis_pemeriksaan +waktu_pemeriksaan_mulai +waktu_pemeriksaan_selesai +tempat_pemeriksaan +tanggal_pemeriksaan +created_at +updated_at

1

+idDetailcekkesehatan +idCekkesehatan +idTransaksi

+Input() +Read() +Update() +Delete() +Search() +Cetak()

Transaksi

+Input() +Delete() +Read() *

*

1

+Input() +Delete() +Read() +Cetak()

Bimbingan

+Input() +Read() +Update() +Delete() +Search() +Cetak() Article

1 KepalaSekretariat

1

Keuangan

+idArticle +judul +isi +type +created_by +created_at +created_updated

* 1

Ketua

+Input() +Update()

1

* *

*

Pengeluaran +idPengeluaran +tanggal +unit +harga_satuan +volume +harga_total +Input() +Update() +Delete() +Search()

Gambar 6. Class Diagram

6

Gambar sequence diatas menggambarkan proses registrasi yang dilakukan oleh calon jamaah. Dimulai dari calon jamaah akses websitenya kemudian pilih menu layanan dan tampil sub menu layanan haji dan umroh. Pilih sub menu layanan haji atau umroh dan selanjutnya pilih pendaftaran haji atau umroh maka sistem menampilkan form pendaftaran haji atau umroh, kemudian input formulir pendaftarannya dan pilih register. Jika calon jamaah ingin mencetak formulirnya maka pilih button cetak.

Pembayaran +idPembayaran +idTransaksi +no_ktp +tanggal +total +status

+idBimbingan +tanggal_bimbingan +waktu_bimbingan_awal +waktu_bimbingan_akhir +tempat_bimbingan +nama_pembimbing

*

Admin dan database

DetailCekKesehatan

+idTransaksi * +no_ktp 1 +no_spph +layanan +tahun_keberangkatan +bulan_keberangkatan +status_jamaah +paket +kamar +total_biaya +status

+Read() +Update() +Delete() +Search() +Cetak()

FrontOffice

+id +desc +value +type

+Input() +Read() +Update() +Delete() +Search() +Cetak()

1 Pegawai

GenericMaster

+idPassport +tanggal_pembuatan +waktu_pembuatan_awal +waktu_pembuatan_akhir +tempat_pembuatan +created_at +updated_at

Gambar 7. Sequence Diagram

H. Tahap Implementasi Tahap implementasi dilakukan pengkodean atau coding dengan bahasa pemrograman PHP menggunakan Adobe Dreamweaver CS6; database disimpan dengan MySQL Versi 5.5.8; testing menggunakan black box testing. I.

Pengujian Sistem Pada tahap ini dilakukan pengujian terhadap sistem informasi pelayanan haji dan umroh berbasis web. Pengujian yang digunakan yaitu pengujian blackbox (eksternal). Pengujian eksternal (blackbox testing) yaitu melakukan pengujian terhadap website dengan cara mengecek satu persatu link yang ada dengan menggunakan tabel pengujian. Apakah link tersebut sudah sesuai seperti yang diharapkan atau belum.

V. KESIMPULAN Berdasarkan uraian dan pembahasan pada babbab sebelumnya, dapat disimpulkan bahwa: 1. Sistem informasi pelayanan haji dan umroh berbasis web ini menyediakan pelayanan seperti pendaftaran bimbingan haji dan umroh secara online, dapat melihat jadwal bimbingan, jadwal cek kesehatan dan pengambilan buku hijau untuk yang haji saja, jadwal pembuatan passport dan pengambilan buku passport untuk jamaahnya dan adanya chat sesama anggota KBIH Al- Karimiyah. 2. Setelah sistem pelayanan haji dan umroh dibuat menghasilkan manfaat bagi perusahaan itu sendiri yaitu memudahkan dalam me-manage data, melihat laporan pendaftaran bimbingan haji dan umroh, mengatur jadwal bimbingan, jadwal cek kesehatan dan jadwal pembuatan passport untuk jamaahnya, menyajikan laporan keuangan per periode untuk ketua KBIH serta laporan pembayarannya. Kemudian biaya yang dikeluarkan oleh perusahaan dalam pemasaran lebih sedikit karena informasi-informasi mengenai haji dan umroh sudah berbasis web. Dan manfaat bagi jamaahnya yaitu bisa mendaftar bimbingan haji dan umroh secara online, sehingga biaya yang dikeluarkan oleh jamaah tidak terlalu besar dan tidak membuangbuang waktu karena tidak perlu datang langsung ke perusahaan. 3. Penyimpanan data ke database sudah terkomputerisasi secara optimal sehingga membantu perusahaan dalam proses penyimpanan, pencarian data dan memberikan report kepada ketua KBIH sesuai yang dibutuhkannya. 4. Telah dilakukan pengujian blackbox testing guna mendapatkan hasil yang maksimal pada KBIH AlKarimiyah yang dibuat agar terhindar dari kesalahan dan berjalan sebagaimana yang diharapkan.

[3] www.haji.kemenag.go.id [4] Kadir, Abdul. 2003. Pengenalan Sistem Informasi, Yogyakarta: Andi. [5] Munawar. 2005. Pemodelan Visual dengan UML. Yogyakarta: Graha Ilmu. [6] Kendall, Kenneth E., dan Kendall, Julie E. 2008. Analisis dan Perancangan Sistem. Ed. 5, Jilid.1. Jakarta: Indeks.

COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benar-benar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

VI. SARAN Berdasarkan kesimpulan-kesimpulan yang telah dijelaskan, maka dapat diajukan beberapa saran untuk pengembangan lebih lanjut diantaranya: 1. Sistem yang dibuat belum mempertimbangkan keamanan datanya, untuk pengembangan selanjutnya agar dipertimbangkan. 2. Sistem yang dibuat masih menggunakan pembayaran secara transfer, untuk pengembangan selanjutnya diharapkan sistem yang bekerja sama dengan bank. REFERENSI [1] Pressman, Roger S. 2002. Rekayasa Perangkat Lunak Pendekatan Praktis. Yogyakarta: Andi [2] Kotler, Philip dan Wasana, Jaka. 2002. Manajemen Pemasaran Analisis, Perancangan dan Pengendalian. Jakarta: Erlangga.

7

RANCANGAN SISTEM INFORMASI ADMINISTRASI REKENING TABUNGAN PADA BAITUL MAAL WAT TAMWIL USAHA MULYA Yasin Efendi1, Saipul Anwaro2, Anung Y Sumantri3 , Amin Fauzi4 1,2,3

Manajemen Informatika,AMIK Wahana Mandiri Jl.Cabe Raya No.51 Pondok Cabe Pamulang Tangerang 15418, Telp.021-74707246,Fax.021-74707250 4

Sistem Informasi Magister Ilmu Komputer, Program Pascasarjana Universitas Budi Luhur Jl. Ciledug Raya, Petukangan Utara, Jakarta Selatan, 12260 DKI Jakarta, Indonesia. Telp: 021-5853753 1, [email protected], 2, [email protected] 3, [email protected] 4, [email protected]

Abstract- Baitul Maal Wat Tamwil Mulya Enterprises is a financial institution which in its management, implementing Shariah Islamic law. Products and services provided by BMT Business Mulya form of savings and financing services. Savings and financing services that have been managed by BMT Enterprises Mulya still using a semi manual system. The purpose here is not semi-manual process of managing all computerized. There is a combination of computerized and manual systems. Along with the development of Shariah financial institutions, it directly adds to the volume of transactions. By semi-manual system because it is now utilized BMT Mulya Enterprises no longer feasible to implement, because semi-manual systems can hamper the smooth operation of business Mulya BMT. These systems will dikembangankan using Structured Analysis and Design System (System Structure Analysis and Design Method). This method divides its activities into 4 (four) stages of the problem definition phase and Feasibility Analysis, System Analysis, System Design and Application Systems. With these changes it is expected that these obstacles were overcome, so the higher the customer confidence and will positively impact business development Mulya BMT as a professional financial institution Shari'ah. Keywords: Information Systems, System Structure Analysis and Design Method, DAD.

I.

PENDAHULUAN

Dalam era globalisasi dengan tingkat perkembangan yang semakin maju dan modern, memang menjadi salah satu faktor yang ikut mendukung bagi pertumbuhan dan perkembangan suatu perusahaan yang handal. Dan ketidak lancaran pengelolaan arus informasi dapat mengakibatkan kesalahan dalam pengambilan keputusan, pengendalian operasional serta perencanaan teknis dan strategis. Pada dewasa ini sepertinya tidak terlalu sulit untuk mewujudkan sistem manajemen yang modern dengan digunakannya komputer sebagai alat bantu. Oleh karena itu usaha untuk mengkomputerisasikan sebuah sistem pada suatu organisasi memang telah menjadi suatu keharusan dan kewajiban demi kelancaran perusahaan tersebut. Penulisan mengenai sistem administrasi rekening tabungan pada BMT Usaha Mulya ini 8

dikarenakan BMT Usaha Mulya mengalami petumbuhan yang cukup signifikan, sampai dengan saat ini jumlah nasabah yang terdaftar berjumlah 110 nasabah. Sedangkan jumlah transaksi yang terjadi selama sebulan rata-rata 50 sampai dengan 100 transaksi. Dengan pertumbuhan yang cukup signifikan tersebut pengelolaan administrasi rekening tabungan harus didukung dengan sistem informasi yang cukup handal agar tidak mengalami hambatan-hambatan dalam pelaksanaan kegiatan administrasi rekening tabungan. Pelaksanaan kegiatan administrasi rekening tabungan yang masih dilakukan secara semi manual dirasakan menghambat dan menyebabkan tersendatnya kegiatan pengadministrasian tersebut. Adapun hambatan-hambatan yang sering dialami akibat sistem yang semi manual tersebut adalah : a.

Apabila calon nasabah ingin melakukan transaksi pembukaan rekening tabungan, maka proses administrasi satu orang calon

b.

c.

d.

e.

f.

nasabah baru itu akan memakan waktu yang cukup lama. Apabila nasabah ingin mengetahui perkembangan saldo atau layanan informasi lainnya tidak dapat dengan cepat terlayani dengan baik dan akurat. Dalam melakukan pencatatan sering terjadi kesalahan seperti merubah, menambah dan mengurangi serta menghapus data nasabah. Hal tersebut terjadi karena faktor manusiawinya yang terkadang bisa lupa atau kelelahan. Apabila pimpinan ingin mengetahui besarnya simpanan tabungan nasabah pada saat tertentu, juga tidak dapat diperoleh informasinya dengan cepat. Dalam hal bentuk simpanan data masih berupa berkas-berkas yang ditumpuk di suatu tempat penyimpanan. Jumlah nasabah yang sudah cukup banyak sehingga sudah tidak memungkinkan lagi untuk dilayani secara manual.

Akibatnya BMT Usaha Mulya maupun nasabah mengalami kendala dalam pelayanan, sehingga menyebabkan kerugian waktu di kedua belah pihak. Kemungkinan terburuk adalah berpindahnya nasabah ke lembaga BMT lainnya.

Tujuan dari penulisan ini adalah untuk membantu Biro Administrasi Rekening Tabungan Baitul Maal Wattamwil Usaha Mulya dalam memperbaiki sistem yang sedang berjalan dengan cara merancang sistem administrasi rekening tabungan yang dapat memberikan hasil pengolahan data informasi transaksi tabungan yang terkini, akurat dan tepat waktu serta dapat dipakai sebagai acuan di dalam mengambil langkah-langkah kebijaksanaan dan keputusan, sehingga kesalahan dalam pengolahan data transaksi tabungan dapat dihindari serta dapat meningkatkan tingkat ketelitian dan tingkat pengendalian yang tinggi dan dapat dipercaya.

Untuk tidak menyimpang pada pokok permasalahan yang sebenarnya mengenai sistem administrasi rekening tabungan BMT Usaha Mulya, penulis hanya membatasi pada lingkup permasalahan yang meliputi proses pendaftaran nasabah, transaksi penyimpanan, transaksi penarikan, transaksi penutupan rekening tabungan serta pembuatan laporan-laporan

1.2 Rumusan Masalah Berdasarkan uraian latar belakang masalah, dapat dirumuskan sejumlah masalah sebagai berikut: 1.

2.

Bagaimana merncang sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya? Bagaimana mengimplementasikan sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya?

1.3 Tujuan Penelitian Adapun yang menjadi tujuan dari penelitian ini adalah: 1.

2.

Merancang sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya, Mengimplementasikan sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya,

. II. METODE PENELITIAN Sistem yang akan dikembangankan ini menggunakan metode Analisa dan Perancangan Sistem Terstruktur ( System Structure Analysis and Design Method ). Metode ini membagi kegiatannya dalam 4 ( empat ) tahap yaitu tahap Pendefinisian Masalah dan Analisa Kelayakan, Analisa Sistem, Perancangan Sistem dan Penerapan Sistem. Tahap Analisa Masalah dan Studi Kelayakan Di dalam tahap ini tugas yang dilakukan adalah mengidentifikasikan masalah-masalah yang terjadi untuk kemudian diselesaikan melalui suatu pengembangan sistem, tahap ini antara lain dilakukan dengan cara : a) Wawancara Wawancara dilakukan dengan pihak-pihak yang terkait dibidangnya masing-masing yang berhubungan dengan sistem rekening tabungan agar data yang diperoleh lebih lengkap. b) Observasi Dengan menggunakan pengamatan ke bagian-bagian yang berhubungan dengan sistem rekening tabungan. Hal ini untuk memperkuat data yang diperoleh pada saat wawancara. c)

Studi Kepustakaan Dilakukan untuk mengumpulkan data-data dengan informasi melalui buku-buku dan 9

bahan pelengkap lainnya sesuai dengan permasalahan dan penulisan ini.

2.

3. a.

Tahap Analisa Sistem

Kegiatan yang dilakukan pada tahap ini adalah : I.

II.

Menganalisa sistem yang ada, yaitu mempelajari dan mengetahui apa yang dikerjakan oleh sistem yang ada. Menspesifikasi sistem, yaitu menspesifikasi masukan yang digunakan, database yang ada, proses yang dilakukan dan keluaran yang dihasilkan.

Produk yang dihasilkan dari tahap ini berupa model dari sistem yang ada, sedangkan alat-alat yang digunakan antara lain : 1.

2.

3.

Diagram Aliran Data ( Data Flow Diagram ) Diagram aliran data digunakan untuk menggambarkan proses atau fungsi-fungsi yang dilakukan oleh sistem. Kamus Data (Data Dictionary) Kamus data digunakan untuk mendefinisikan arus data, simpanan data dan proses yang terdapat pada diagram aliran data. Diagram Hubungan Entitas ( Entity Relationship Diagram ) Diagram hubungan entitas digunakan untuk menggambarkan hubungan antara data store yang ada di dalam diagram aliran data.

b. Tahap Perancangan Sistem

Tahap Perancangan Sistem adalah merancang sistem secara rinci berdasarkan hasil analisa sistem yang ada, sehingga menghasilkan model sistem baru yang akan diusulkan, dengan disertai rancangan database dan spesifikasi program. Alat-alat yang digunakan pada tahap perancangan sistem ini antara lain sama dengan pada tahap analisa sistem dan ditambah sebagai berikut : 1. LRS ( Logical Record Structure ) LRS terdiri dari link-link diantara tipe record. Link ini menunjukkan arah dari satu tipe record lainnya. 10

4.

5.

Penelusuran Akses ( Access Path ) Yaitu penelusuran akses yang dipakai untuk memilih kunci file selama perancangan database. Bagan Terstruktur ( Structure Chart ) Bagan Terstruktur digunakan untuk mendefinisikan dan mengilustrasikan organisasi dari sistem informasi secara berjenjang dalam bentuk modulmodul dan submodul. Pseudocode Digunakan untuk menggambarkan algoritma dalam bentuk kode-kode yang menyerupai instruksi program yang sebenarnya. Normalisasi Untuk mengorganisasikan file dengan menghilangkan group elemen yang berulang atau sebuah langkah atau proses untuk menyederhanakan hubungan elemen data di dalam tuple ( record ) dapat dilakukan dengan cara normalisasi.

III. LANDASAN TEORI Konsep Dasar Sistem Informasi Manajemen Pengertian Sistem Dalam sebuah sistem terdapat dua pendekatan di dalam pendefinisian sistem, yaitu yang menekankan pada prosedur dan pada komponen ( elemen ). 1) Pendekatan sistem yang menekankan pada elemen-elemen atau komponen. Kelompok yang menekankan pada prosedurnya diantaranya adalah Raymond McLeod, Jr dan George Schell. (2001 : 9) mendefinisikan sistem sebagai berikut : “Sistem adalah sekelompok elemen-elemen yang terintegrasi dengan maksud yang sama untuk mencapai suatu tujuan”. Sedangkan menurut Steven A. Moscove (1981 : 4) sistem dapat didefinisikan sebagai berikut : “Sistem adalah suatu kesatuan (entity) yang terdiri dari bagianbagian (disebut subsistem) yang saling berkaitan dengan tujuan untuk mencapai tujuan tertentu”.

2) Pendekatan sistem yang menekankan prosedurnya. Kelompok yang menekankan pada prosedurnya diantaranya adalah Jerry Fitz Gerald et al. (1981 : 5) mendefinisikan : “Sistem adalah suatu jaringan kerja dari prosedur-prosedur yang saling berhubungan, berkumpul bersama-sama untuk melakukan suatu kegiatan atau untuk menyelesaikan suatu sasaran tertentu”. Pendekatan sistem yang merupakan jaringan kerja dari prosedur menekankan urutan-urutan operasi di dalam sistem.Prosedur yang didefinisikan Jerry Fitz Gerald at al. (1981 : 6) mendefinisikan sebagai berikut : “Prosedur adalah urutan-urutan yang tepat dari tahapan-tahapan instruksi yang menerangkan apa (what) yang harus dikerjakan, dan siapa (who) yang akan mengerjakan, kapan (when) dan bagaimana (how) mengerjakannya”.

Dari kedua pendekatan sistem tersebut di atas, dapat disimpulkan bahwa suatu sistem terdiri dari beberapa subsistem atau sistem-sistem bagian. Komponen-komponen atau subsistem-subsistem tersebut saling berinteraksi dan saling berhubungan membentuk satu kesatuan sehingga tujuan atau sasaran sistem dapat tercapai. Interaksi dari subsistem-subsistem sedemikian rupa, sehingga dicapai suatu kesatuan yang terpadu atau terintegrasi.

Sistem mempunyai karakteristik / sifat-sifat, yaitu antara lain sebagai berikut : Komponen sistem ( components ) Suatu sistem terdiri dari sejumlah komponen / elemen yang saling berinteraksi, artinya komponen atau elemen yang saling bekerjasama dalam bentuk satu kesatuan.

Komponen atau elemen sistem dapat berupa subsistem / bagian-bagian dari sistem. Setiap subsistem mempunyai sifat-sifat dari sistem untuk menjalankan suatu fungsi tertentu dan mempengaruhi proses sistem secara keseluruhan. Batasan sistem ( system boundary ) Boundary adalah daerah yang membatasi antara suatu sistem dengan sistem yang lainnya / dengan lingkungan luarnya. Batasan sistem tersebut memungkinkan suatu sistem dipandang sebagai satu kesatuan. Dan batas suatu sistem juga memungkinkan ruang scope (lingkup) dari sistem tersebut. Lingkungan luar sistem ( environment ) Environment adalah suatu sistem yang merupakan apapun diluar batas dari sistem yang mempengaruhi operasi sistem. Penghubung sistem ( interface ) Interface merupakan suatu media penghubung antar satu subsistem dengan subsistem yang lainnya. Output (keluaran) dari satu subsistem akan menjadi input (masukan) untuk subsistem yang lainnya dengan melalui penghubung. Dengan penghubung satu subsistem dapat saling berintegrasi dengan subsistem yang lainnya untuk membentuk satu kesatuan. Masukan sistem ( input ) Masukan suatu sistem adalah merupakan energi yang dimasukan kedalam sistem. Masukan tersebut dapat berupa maintenance input (masukan perawatan) dan signal input (masukan sinyal). Maintenance input adalah energi yang dimasukan supaya sistem tersebut dapat beroperasi. Misalnya, di dalam sistem komputer, suatu program adalah maintenance input yang digunakan untuk mengoperasikan komputernya. Sedangkan signal input adalah energi yang diproses untuk mendapatkan keluaran. Sebagai contohnya di dalam 11

group of managers who represent an organizational unit such as a management level or business area”.

sistem komputer, data adalah signal input untuk diolah menjadi informasi. Keluaran sistem ( output ) Keluaran sistem adalah hasil dari energi yang diolah dan diklasifikasikan menjadi keluaran yang berguna dan sisa pembuangan. Keluaran juga dapat merupakan masukan untuk subsistem yang lain.

Sedangkan pengertian Sistem Informasi Manajemen menurut Jeffrey L. Whitten el al (2001 : 47) adalah :

Pengolah sistem ( process ) Pengolahan sistem dapat merupakan suatu bagian pengolah yang akan merubah masukan menjadi keluaran. Suatu sistem proses order jasa akan mengolah data order menjadi laporanlaporan keuangan berupa invoice tagihan dan laporan-laporan lain yang dibutuhkan oleh manajemen.

“Management Information System (MIS) is an information system application that provides for management oriented reporting. These report are susually genereted on a predetermined schedule and appear in a prearranged format”.

Tujuan ( goal ) atau sasaran ( objectives ) sistem Suatu sistem mempunyai maksud tertentu, ada yang bermaksud untuk mencapai suatu tujuan, misalnya sistem bisnis dan ada yang bermaksud untuk mencapai suatu sasaran, misalnya sistem akuntansi atau subsistem-subsistem yang merupakan bagian dari sistem bisnis. Goal biasanya dihubungkan dengan ruang lingkup yang lebih luas, dan sasaran dihubungkan dengan ruang lingkup yang lebih sempit. Sasaran suatu sistem sangat menentukan masukan yang dibutuhkan sistem dan keluaran yang akan dihasilkan sistem. Suatu sistem dikatakan berhasil jika mengenai sasaran atau tujuan yang diharapkan.

Pengertian Sistem Informasi Manajemen Sistem Informasi Manajemen menurut Raymond McLeod, Jr dan George Schell (2001 : 13) didefinisikan sebagai berikut : “Management information system (MIS) as an information producing system that support a 12

Sistem ini menggunakan perangkat keras (hardware) dan software (perangkat lunak) komputer, prosedur pedoman, model manajemen dan keputusan dan sebuah database. Maka dapat disimpulkan bahwa sistem informasi manajemen harus mengandung komponen-komponen fisik seperti berikut :

a. b.

Perangkat keras (hardware). Perangkat lunak (software), perangkat lunak sistem umum dan terapan umum.

c.

Pangkalan data (database), data yang tersimpan dalam media penyimpanan komputer. Prosedur Petugas pengoperasian

d. e.

Dengan demikian dapat disimpulkan sistem informasi manajemen merupakan kumpulan dari interaksi sistem-sistem informasi dan dapat menghasilkan informasi yang benar untuk semua tingkatan manajemen.

Konsep Dasar Rekening Tabungan Menurut Jusuf ( 1992:1 ) perekonomian tersusun dari berbagai sistem yang terdiri dari subsub sistem. Salah satu sistem tersebut terdapat sistem perbankan. Kegiatan bank itu sendiri merupakan mata rantai dari bagian yang berdiri sendiri dimana terdapat bank senctral, bank umum dan bank dagang. Sebuah bank adalah merupakan bagian sub sistem dari keseluruhannya. Ini merupakan bagian dari struktur tingkat tinggi dan yang dengan sendirinya membentuk serangkaian sistem-sistemnya.

Pada dasarnya bank adalah lembaga perantara antar factor yang kelebihan dana dengan sector yang kekurangan dana. Bank menerima simpanan dana dari pihak yang kelebihan dana dalam bentuk tabungan atau deposito, dan menyalurkan dana ke pihak yang memerlukannya dalam bentuk pinjaman.

Dana yang ditempatkan di bank, si surplus akan menerima tingkat penembalian tertentu dari bank sebagai imbalannya yang dekenal dengan nama interest (bunga). Sedangkan pada si minus yang menggunakan dana dari bank harus membayar bunga kepada bank. Laba bank diperoleh dari selisih bunga yang diterima dari pemberian kredit dengan bunga yang dikerluarkan untuk pada deposan atau penabung. Karena memperoleh suntikan dana dari bank berupa kredit maka sektor minus dapat mengadakan investasi baru atau membiayai modal kerja, sehingga dapat menggerakkan sektor riil perekonomian negara.

Rekening Tabungan Menurut undang-undang, bank terdiri dari 2 ( dua ) jenis yaitu Bank Umum dan Bank Perkreditan Rakyat ( BPR ). BPR sendiri adalah suatu bank yang menerima simpanan hanya dalam bentuk deposito berjangka, tabungan dan atau bentuk lainnya yang dipersamakan dengan itu.

setiap saat atau sewaktu-waktu tanpa pemberitahuan terlebih dahulu kepada bank dengan menggunakan slip pengambilan.

Untuk menjadi penabung bisa dari semua lapisan masyarakat secara perorangan atau yayasan, dan sebagai bukti tabungan maka bank akan menerbitkan buku tabungan atas nama si penabung. Pada setipa akhir bulan si penabung akan menerima imbalan dari bank berupa bunga karena menemptkan dana di bank tersebut.

IV. ANALISA PROSES Gambaran prosedur yang terjadi pada Sistem Informasi Administrasi Rekening Tabungan yang sedang berjalan setelah disesuaikan dengan ruang lingkup sistem yang akan dibuat terdiri dari :

a. DAD Sistem Berjalan Untuk menggambarkan Sistem Informasi Administrasi Rekening Tabungan yang sedang berjalan secara logika, maka digunakan alat bantu berupa DAD. DAD sistem yang berjalan digambarkan sebagai berikut :

PEMOHON

Form_Permohonan FC_KTP

Buku_Tabungan

Slip_Setoran Slip_Pengambilan

0.0 SISTEM ADMINISTRASI REKENING TABUNGAN BMT USAHA MULYA

NASABAH

Buku_Tabungan_Isi

Lap_Laba_Rugi

DIREKTUR

Gambar. 1 Diagram Konteks Sistem Berjalan

Rekening Tabungan adalah simpanan pihak ketiga di bank yang penarikannya dapat dilakukan 13

PEMOHON

Form_Permohonan FC_KTP Buku_Tabungan

Uraian Kebutuhan Sistem Mendatang diharapkan dengan adanya sistem yang terkomputerisasi dapat membantu dalam mengatasi masalah diatas dan mengatasi masalah pemenuhan kebutuhan, antara lain :

1.0 PEMBUKAAN TABUNGAN

Rekening

a)

Simpanan data berbentuk File bukan Arsip. b) Pengidentifikasi data, perhitunganperhitungan, pencatatan, pembuatan laporan diharapkan lebih cepat dan akurat. c) Meminimalkan waktu dalam melakukan setiap kegiatan.

2.0 Slip_Setoran

PENYETORAN TABUNGAN

NASABAH

Buku_Tabungan_Isi

Buku_Tabung Slip_Pengambilan

3.0 PENARIKAN TABUNGAN

Buku_Tabungan_Isi

Rekening

4.0.P Slip_Pengambilan

PENUTUPAN TABUNGAN

Buku_Tabung

RANCANGAN SISTEM 5.0.P LAPORAN

DIREKTUR

Lap_Laba_Rugi

1. Gambar. 2 Diagram Overview Sistem Usulan

Identifikasi Kebutuhan Hasil Analisa Berdasarkan hasil analisa yang berjalan mengenai sistem administrasi rekening tabungan yang dilakukan secara manual, maka didapat kekurangan-kekurangan sebagai berikut :

a)

Kebutuhan akan informasi yang tepat waktu dan akurat untuk pihak manajemen atau manager tidak terpenuhi. b) Kesalahan perhitungan maupun kesalahan pencatatan. c) Waktu pelaksanaan tiap-tiap proses relatif lama. d) Sering tedapat kesalahan pada keluaran sistem, seperti kesalahan cetak pada laporan dan lain-lain.

14

Rancangan Basisi Data Rancangan Sistem Administrasi Rekening Tabungan Pada BMT Usaha Mulya didasarkan pada pemecahan masalah, yang merupakan pemecahan dari kendala-kendala yang dihadapi oleh sistem yang sedang berjalan. Untuk melakukan rancangan basis data yaitu dengan mengubah Diagram E-R menjadi bentuk Logical Record Structure (LRS), mengubah LRS ke dalam bentuk relasi, kemudian menormalisasikan basis data sehingga benar-benar sedikit mungkin munculnya duplikasi data.

a.

Model Data Dalam model data akan di gambarkan hubungan datanya dengan menggunakan Diagram-ER. Dari hasil analisa sistem bisa di gambarkan model datanya sebagai berikut :

NASABAH 1

Tgl_Basil NilaiBasil

No_Rek

BASIL

M

LOG

ZAKAT

M

LOG

MILIK

1

Tgl_Zakat NilaiZakat

AJUKAN

1

No_Nsbh No_Rek

M

PUNYA

1 No_Rek Tgl_Buka Saldo

TULIS

No_Rek No_Form

Adapun file yang terdapat pada LRS berjumlah 9 (sembilan) file yaitu :

M

REKENING 1

No_Rek

No_Nsbh No_KTP Nama_Nsbh Jk_Nsbh Alm_Nsbh Telp_Nsbh Tpt_Lahir Tgl_Lahir Pekerjaan

1

No_Rek Kd_Tab

JENIS TABUNG Kd_Tab Jenis_Tab Biaya_Adm

No_Rek No_Slip

1. 2. 3. 4. 5. 6. 7. 8. 9.

File Nasabah File Rekening File Jns_Tab File Trans File Pegawai File Slip File Basil File Zakat File Tutup

M SLIP TRANSAKSI No_Form FORM TUTUP Tgl_Tutup TABUNGAN B_Adm

CATAT

M 1 SAH

M

M No_Slip Tgl_Slip Jml_Trans

1

1

PEGAWAI

No_Form No_Peg

ISI

1

No_Slip Kd_Trans

JENIS TRANSAKSI Kd_Trans Jenis_Trans

Dari diagram E-R sistem administrasi rekening tabungan di BMT Usaha Mulya dan dengan mengikuti aturan yang telah dijelaskan di atas, maka proses transformasi dari diagram E-R ke LRS dapat digambarkan sbb :

No_Slip No_Peg

No_Peg Nama_Peg Alamat_Peg Tp_Lhr_Peg Tg_Lhr_Peg Jk_Peg Telp_Peg Pendidikan

Gambar. 3

NASABAH 1

Entity Relationship Diagram (E-R Diagram)

Tgl_Basil NilaiBasil

No_Rek

BASIL

M

LOG

ZAKAT

M

LOG

MILIK

1

Tgl_Zakat NilaiZakat

PUNYA

1

No_Rek Kd_Tab

J TA Kd_ Jen Biay

No_Rek No_Slip

M SLIP TRANSAKSI

M

M No_Slip Tgl_Slip Jml_Trans

1 FORM TUTUP TABUNGAN

No_Form Tgl_Tutup B_Adm

CATAT

M 1

Memperhatikan bagaimana langkahlangkah diagram E-R usulan dirubah ke bentuk LRS. Dalam kaitannya dengan transformasi dari diagram E-R ke LRS, perubahan yang terjadi mengikuti aturanaturan berikut : 1. Setiap entitas akan diubah ke bentuk sebuah kotak dengan nama entitas berada di dalam kata. 2. Sebuah relasi kadang disatukan dengan sebuah kotak bersama entitas kadang dipisah dalam kotak tersendiri. Aturan di atas berlaku sangat dipengaruhi oleh elemen yang menjadi titik perhatian utama pada langkah transformasi, yaitu pada cardinality (tingkat hubungan). Cardinality antar entitas (1:1, 1:M, M:N) sangat mempengaruhi bagaimana transformasi harus dilakukan.

M

1 No_Rek Tgl_Buka Saldo

TULIS

No_Rek No_Form

No_Nsbh No_Rek

M

REKENING 1

No_Rek

AJUKAN

b. Transformasi Diagram E-R ke Logical Record Structure

1

No_Nsbh No_KTP Nama_Nsbh Jk_Nsbh Alm_Nsbh Telp_Nsbh Tpt_Lahir Tgl_Lahir Pekerjaan

1

SAH

PEGAWAI

No_Form No_Peg

ISI No_Slip Kd_Trans

1

J TRA Kd_ Jen

No_Slip No_Peg

No_Peg Nama_Peg Alamat_Peg Tp_Lhr_Peg Tg_Lhr_Peg Jk_Peg Telp_Peg Pendidikan

Gambar. 4 Transformasi E-R Diagram ke LRS NASABAH

BASIL No_Rek Tgl_Basil NilaiBasil

No_Rek

No_Nsbh No_KTP Nama_Nsbh Jk_Nsbh Alm_Nsbh Telp_Nsbh Tpt_Lahir Tgl_Lahir Pekerjaan

No_Nsbh

ZAKAT No_Rek Tgl_Zakat NilaiZakat

JNS_TAB

REKENING No_Rek

No_Rek Tgl_Buka Saldo No_Nsbh (FK) Kd_Tab (FK)

Kd_Tab

Kd_Tab Jenis_Tab Biaya_Adm

No_Rek

TUTUP No_Form Tgl_Tutup B_Adm No_Rek (FK) No_Peg (FK)

SLIP No_Rek

TRANS Kd_Trans

No_Slip Tgl_Slip Jml_Trans No_Rek (FK) No_Peg(FK) Kd_Trans (FK)

Kd_Trans Jenis_Tran

No_Peg

Gambar. 5

PEGAWAI No_Peg Nama_Peg Alamat_Peg Tp_Lhr_Peg Tg_Lhr_Peg Jk_Peg Telp_Peg Pendidikan

Logical Record Structure

15

Rancangan Proses V. KESIMPULAN Dari hasil pembahasan diatas disimpulkan sebagai berikut:

a. DAD Usulan Berikut ini gambar rancangan proses yang di modelkan dalam diagram arus data (DAD) :

1.

Dt_Nasabah Dt_Rekening Form_Tutup_Tab Slip_Transaksi Nasabah

Pegawai

0.0 SISTEM INFORMASI ADMINISTRASI REKENING TABUNGAN PADA BMT USAHA MULYA

Dt_Pegawai

Bukti_Transaksi Bukti_Penutupan

2.

Dt_Transaksi Dt_Jenis_Tab

dapat

Perancangan sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya? menggunakan Diagaram Arus Data (DAD), ERD, Konversi ERD ke LRS dan LRS yang dihasilkan, dengan rancangan ini diharapkan dapat menyelesaikan masalah dalam transaksi sistem administrasi rekening tabungan pada Baitul Maal Wat Tamwil Usaha Mulya Sistem administrasi rekening tabungan ini di terapkan untuk menggantikan sistem yang lama pada pada Baitul Maal Wat Tamwil Usaha Mulya

Direktur Lap_Basil Lap_Zakat Lap_Saldo_Nasabah Lap_Transaksi Lap_Data_Nasabah Lap_Data_Pegawai Lap_Tab_Baru Lap_Tutup_Tab Lap_Jenis_Tab

Saran Pengembangan sistem yang diusulkan sangat diperlukan sekali, maka langkah pendukung yang berguna bagi kelangsungan hidup sistem itu. Hal-hal yang patut diperhatikan antara lain :

Gambar. 6 Diagram Konteks Sistem Usulan

Pegawai Dt_Pegawai

1.0

a. Direktur

Dt_Transaksi Dt_Jenis_Tab

Entry File Master

Trans

Pegawai Jns_Tab

b. 2.0 Nasabah

Dt_Rekening Dt_Nasabah Form_Tutup_Tab Slip_Transaksi

Pelayanan Tabungan

Rekening

c.

Tutup Bukti_Transaksi Bukti_Penutupan Buku_Tabungan

Nasabah

Slip

d.

3.0 Pengolahan Bagi Hasil dan Zakat

Nasabah Basil Rekening Zakat

4.0

Trans Jns_Tab

Pencetakan Laporan

Pegawai

Direktur Tutup

Lap_Basil Lap_Zakat Lap_Saldo_Nasabah Lap_Transaksi Lap_Data_Nasabah Lap_Data_Pegawai Lap_Tab_Baru Lap_Tutup_Tab Lap_Jenis_Tab

Gambar. 7 Diagram Overview Sistem Usulan

16

Kepuasan dan pelayanan terhadap Nasabah harus diprioritaskan dan harus menjadi perhatian yang utama, karena hal tersebut merupakan pemasukan aset yang sangat bermanfaat bagi perkembangan perusahaan. Mengadakan evaluasi secara berkala untuk melihat apakah diperlukan adanya perbaikan atau penyempurnaan sistem. Melakukan pemeriksaan secara teratur dan berkala terhadap perangkat keras dan perangkat lunak. Setiap user id diharapkan dapat melindungi sistem dari penyalahgunaan diluar aturan yang diberikan, untuk itu disarankan : a) Setiap user id yang login perlu dicatat tanggal, jam dan tempat kejadian. b) Setiap user id yang login dengan beberapa kali kesalahan passwordnya akan dinonaktifkan sementara sampai adanya autorisasi oleh pejabat yang berwenang.

Daftar Pustaka [1] [2]

Al-Bahra. (2005). Analisis dan Desain Sistem Informasi. Graha Ilmu. Jogiyanto, “Analisis & Disain Sistem Informasi:Pendekatan Terstruktur Teori dan Praktek Aplikasi Bisnis”, Yogyakarta: ANDI, 2005

[3]

Leslie A. C. a, “Information System Quality and Value : A Comparison Study of User Versus IS Perceptions” (Number 3, 1991). Journal of Information Technology Management 2 , 20, 1991

[4]

McLeod R, J. G, “Sistem Informasi Manajemen”, Jakarta: Index, 2004

[5]

Sugiono, “Metode Penelitian Bisnis (Pendekatan Kuantitatif, Kualitatif, dan R&D)”, Bandung: Alfabeta, 2009

[6]

Sucipto, S. (2011). Konsep dan Teknik Pengembangan Sistem Berbasis Teknologi Informasi. Banten: Dinas Pendidikan Provinsi Banten.

COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benar-benar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

17

RANCANG BANGUN SISTEM PENGGAJIAN GURU MENGGUNAKAN AKAD IJARAH PADA SMK SALAFIYAH SYAFI’IYYAH Yuni Sugiarti1, Abdul Wadud 2 dan Sigit Apriyanto3 1,2

Dosen dan cMahasiswaJurusan Sistem Informasi Fakultas Sains dan Teknologi Universitas Islam Negeri Syarif Hidayatullah Jakarta Jl. Ir. H. Juanda No 95 Jakarta 15412 1 [email protected], 2 [email protected],

Abstract The purpose of this research is to design a system wake teacher payroll data processing using Ijarah contract on vocational Salafiyah Syafi'iyyah Pangkalan Jati, include: analysis, design and implementation of the system. Payroll system is an important function that is the responsibility of human resource management. Slow data processing and calculation errors can result in slow presentation of information, resulting in delays in payment of salaries. The research methodology consists of data collection methods and systems development methods. Data collection methods used were interviews, observation and literature study. System development method used is a Rapid Application Development (RAD) with tools Unified Modeling Language (UML). Website research results that teacher payroll data processing system at SMK Salafiyah Syafi'iyyah Pangkalan Jati, to facilitate the update data and provide accurate information for each payroll teacher at the desired time. Keywords: payroll system, contract, Ijarah, teacher.

I.

PENDAHULUAN

Di era globalisasi ini, kehidupan manusia tidak dapat terlepas dari arus komunikasi dan informasi yang telah menjelma menjadi suatu kekuatan tersendiri dalam persaingan global yang semakin kompetitif. Kebutuhan akan teknologi, baik itu teknologi informasi maupun telekomunikasi sangat tinggi mulai dari golongan menengah ke bawah dan golongan menengah ke atas.Informasi menjadi suatu faktor yang sangat penting dalam mencapai suatu tujuan yang diinginkan. Suatu organisasi atau perusahaan tentunya memiliki banyak data yang harus diolah, dimana pengolahan data merupakan suatu kegiatan pengolahan kumpulandatayangbelum bermanfaat menjadi lebih bermanfaat.Pengolahan data bisa merupakan suatu manipulasi data, kumpulan data penyimpanan data bahkan pendokumentasian data. Seiring dengan perkembangan sistem informasi yang semakin pesat, penggunaan komputer memegang peranan penting dalam berbagai bidang yang saling mendukung dalam aspek kehidupan. Termasuk didalamnya sistem pengolahan data dan informasi yang tidak dapat begitu saja dipisahkan dengan kehidupan kita sehari-hari. Karena tanpa adanya sistem pengolahan data, maka kegiatan dalam sebuah organisasi tidak akan berjalan dengan lancar 18

seperti yang diharapkan baik dari segi waktu maupun ketepatan kinerja yang dihasilkan. Hal ini menjadi hambatan untuk aktifitas dan pelaksanaan kegiatan sekolah. Dalam suatu organisasi pasti memiliki karyawan, dimana setiap bulan mereka akan menerima gaji sebagai imbalan yang harus dibayarkan kepada karyawan karena jasa atau hasil kerjanya pada suatu perusahaan atau instansi.Masalah penggajian termasuk masalah yang rumit, sebab masalah ini tidak saja menyangkut berapa rupiah seorang karyawan yang harus digaji atas pekerjaannya, melainkan juga memiliki implikasi yang luas ditinjau dari sistem pengupahan. Sistem yang digunakan saat ini masih menggunakan sistem manual, sehingga dalam proses perhitungan gaji masih menggunakan waktu yang lambat, maka dengan adanya sistem komputerisasi ini diharapkan akan lebih mempermudah pekerjaan manusia, dimana komputer dibutuhkan untuk membantu dalam menghitung gaji agar lebih cepat dalam penghitungan. Efesien dalam penggunaan waktu penyelesaian dan terhindar dari kesalahan perhitungan.

Hubungan individu dengan lainnya, seperti pembahasan masalah hak dan kewajiban, harta, jualbeli, kerjasama dalam berbagai bidang, pinjam meminjam, sewa menyewa, penggunaan jasadan kegiatan-kegiatan lainnya yang sangat diperlukan manusia dalam kehidupan sehari-hari. Selainitu, diturunkannya Al-Qur’an sebagai petunjuk umat manusia dapat dijadikan pegangan untuk mengajarkan kepada kita bahwa hidup menyendiri yang permanen bagi satu makhluk, tidak tepat dalam ajaran Islam. Tujuan utama akadijarah yaitu saling membantu dan saling mencukupi terhadap apa yang mereka butuhkan, dimana dalam akadijarah pihak penyewa butuh terhadap pemilikan manfaat atas barang sedangkan pihak yang menyewakan membutuhkan harga atau pembayaran atas pemberian manfaat suatu barang, bukan barangnya tetapi manfaatnya AkadIjarah adalah suatu bentu kaktifitas antara dua pihak yang berakad guna meringankan salah satu pihak atau saling meringankan dan merupakan bentuk tolong-menolong yang diajarkan agama. AkadIjarah pada prakteknya adalah melakukan akad untuk mengambil manfaat sesuatu yang diterima dari orang lain dengan jalan membayar sesuatu dengan perjanjian yang telah ditentukan dengan syarat-syarat yang sesuai dengan ketentuan syar’iah. Bentuk akadijarah ini sangat dibutuhkan dalam kehidupan sehari-hari manusia dan syari’at Islam membenarkan. Seseorang kadang dapat memenuhi salah satu kebutuhan hidupnya melalui proses pembelian, karena jumlah uang yang terbatas cukup dengan cara sewa menyewasaja. Maka disamping akad jual-beli akadijarah mempunyai peranan yang sangat penting dalam kehidupan seharihari, kesulitan akan timbul seandainya sewa menyewa tidak dibenarkan dalam Islam. SMK Salafiyah Syafi’iyyah masih melakukan pembayaran upah atau sistem penggajian secara manual. Membutuhkan proses yang sangat lama untuk mecari data penggajian karyawan dan guru. Jadi masih banyak file untuk menghitung pengeluaran gaji dalam sebulan. Menjadi kendala tatausaha untuk memonitoring pembayaran gaji dalam sebulan. Oleh karena itu salah satu pemecahannya adalah merancang bangun sistem penggajian guru menggunakan akad ijarah pada SMK Salafiyah Syafa’iyyah.

II.

Kajian Literatur

Sistem Informasi Berbasis Web adalah seperangkat komponen yang saling berhubungan yang berfungsi mengumpulkan, memproses, menyimpan, dan mendistribusikan informasi untuk mendukung pembuatan keputusan dan pengawasan dalam organisasi. Web atau WWW (Word Wide Web) adalah sebuah metode baru yang berjalan di dunia internet yang berkembang dengan cepat, dengan media ini dapat menciptakan puluhan bahkan ratusan aplikasi yang berjalan di bawah Web (under web). PHP adalah salah satu aplikasi program yang biasa digunakan dalam media internet saat ini. Databasenya adalah MySQL yaitu database server yang dapat berjalan di dalam media online sehingga database ini mudah dikelola oleh penggunanya. [1]. MySQL merupakan RDBMS (Relational Data Base Management Sistem). MySQL didistribusikan secara open source dan gratis mulai tahun 1996, tetapi mempunyai sejarah pengembangan sejak tahun 1979. A. Pemrograman PHP PHP diperkenalkan pertama kali oleh J Wynia adalah seorang pria yang memiliki dasar yang matang tentang pemrograman, khususnya pemrograman pada sisi server. PHP adalah bahasa pemrograman berbasis web. Bahasa ini mempunyai kelebihan yaitu kompabilitasnya dengan berbagai macam jenis database, dukungan dengan berbagai macam jenis sistem operasi. PHP lebih cocok dan umum digunakan jika digabungkan dengan database MySQL. MySQL dengan PHP seakan-akan dua hal yang tidak dapat dipisahkan. Open source, karenanya gratis dan bebas. Database pasangannya biasanya MySQL, dijalankan bersama webserver Apache di atas sistem operasi Linux. B. Database dengan MySQL MySQL merupakan RDBMS (Relational Data Base Management Sistem). MySQL didistribusikan secara open source dan gratis mulai tahun 1996, tetapi mempunyai sejarah pengembangan sejak tahun 1979. Database MySQL adalah database yang sangat powerfull, stabil, mudah. MySQL sangat banyak dipakai dalam sistem database web dengan menggunakan PHP. PHPTriad juga memberikan fasilitas database yang. Karena PHPTriad dilengkapi dengan database MySQL maka terdapat tempat untuk menyimpan data (store), dan untuk mengambil kembali data anda (retrieve). Seperti sistem database SQL (Structured Query Language) yang lain, MySQL juga dilengkapi dengan perintah-perintah dan sintakssintaks SQL, dengan keunggulan sebagai berikut. 1. Konsep database MySQL berkecepatan tinggi tentang sistem penyajian data. 2. Harga yang relatif murah, karena ada yang dapat diperoleh secara gratis 19

3. Sintaks bahasanya menggunakan perintah yang sederhana. 4. Dapat bekerja dalam beberapa sistem operasi seperti Windows, Linux, MacOs, Unix (Solaris, AIX, dan DEC Unix), FreeBSD, OS/2, Irix. 5. Dukungan penggunaan banyak tersedia [2].

B.3. Rapid Applicaation Development (RAD) RAD adalah sebuah strategi pengembangan sistem yang menekankan kecepatan pengembangan melalui keterlibatan pengguna yang ekstensif dalam konstruksi, cepat, berulang dan bertambah serangkain prototipe / prototipe bekerja sebuah sistem yang pada akhirnya berkembang kedalam sistem final (atau sebuah versi). [3] Berikut diagram yang menerangkan rute dalam RAD, yaitu:

workshop. Selama workshopdesignRAD, pengguna merespon working prototype yang ada dan menganalisa, memperbaiki modul-modul yang dirancang menggunakan perangkat lunak berdasarkan respon pengguna. 3. Fase Implementasi Analis bekerja secara intens dengan pengguna selama workshop design untuk merancang aspekaspek bisnis dan non-teknis dari perusahaan. Segera setelah aspek-aspek ini disetujui dan sistem dibangun dan di-sharing,sub-sub sistem di ujicoba dan diperkenalkan kepada perusahaan. Workshop

Design Implementation

Requirements Planning Identify Objectives and Information R i t

Work with Users to Design S t

Gambar 1 Strategi RAD [3]

Gambar 2. Tahapan RAD [4].

Rapid Application Development (RAD) merupakansalah satu metode prototyping yang memiliki tahapan-tahapan berikut [4] :

B.4. Pengertian Ijarah

1. Perencanaan Syarat-syarat Dalam fase ini pengguna dan penganilisis bertemu untuk mengidentifikasi tujuan-tujuan aplikasi atau sistem serta mengidentifikasi syarat-syarat informasi yang ditimbulkan dari tujuan-tujuan tersebut. Fase ini memerlukan peran aktif dari kedua belah pihak tersebut. Selain itu juga melibatkan pengguna dari beberapa level yang berbeda dalam organisasi. Orientasi dalam fase ini ialah menyelesaikan masalah - masalah perusahaan. Meskipun teknologi informasi dan sistem bisa mengarahkan sebagian dari sistem yang diajukan, fokusnya akan selalu tetap pada upaya pencapaian tujuan perusahaan 2. Workshop Design Fase ini adalah fase untuk merancang dan memperbaiki yang dapat digambarkan sebagai 20

Build the Syste m

Introd uce the New S t

Kata Al-ijarah sendiri berasal dari kata Al ajru yang diartikan sebagai Al 'Iwadhu yang mempunyai arti ”ganti”, al-kira`, yang mempunyai arti ”bersamaan” dan al-ujrah yang memiliki arti ”upah” [5]. Pengertian al-ijarah menurut istilah syariat Islam terdapat beberapa pendapat sebagai berikut: 1. Para ulama dari golongan Hanafiyah berpendapat, bahwa al-ijarah adalah suatu transaksi yang memberi faedah pemilikan suatu manfaat yang dapat diketahui kadarnya untuk suatu maksud tertentu dari barang yang disewakan dengan adanya imbalan. 2. Ulama Mazhab Malikiyah mengatakan, selain alijarah dalam masalah ini ada yang diistilahkan dengan kata al-kira`, yang mempunyai arti bersamaan, akan tetapi untuk istilah al-ijarah mereka berpendapat adalah suatu `aqad atau

perjanjian terhadap manfaat dari al-Adamy (manusia) dan benda-benda bergerak lainnya, selain kapal laut dan binatang, sedangkan untuk al-kira` menurut istilah mereka, digunakan untuk `aqad sewa-menyewa pada benda-benda tetap, namun demikian dalam hal tertentu, penggunaan istilah tersebut kadang-kadang juga digunakan. 3. Ulama Syafi`iyah berpendapat, al-ijarah adalah suatu aqad atas suatu manfaat yang dibolehkan oleh Syara` dan merupakan tujuan dari transaksi tersebut, dapat diberikan dan dibolehkan menurut Syara` disertai sejumlah imbalan yang diketahui. 4. Hanabilah berpendapat, al-ijarah adalah `aqad atas suatu manfaat yang dibolehkan menurut Syara` dan diketahui besarnya manfaat tersebut yang diambilkan sedikit demi sedikit dalam waktu tertentu dengan adanya `iwadah. Berdasarkan beberapa pengertian di atas, maka dapatlah dikatakan bahwa dalam hal `aqad ijarah dimaksud terdapat tiga unsur pokok, yaitu pertama, unsur pihak-pihak yang membuat transaksi, yaitu majikan dan pekerja. Kedua, unsur perjanjian yaitu ijab dan qabul, dan yang ketiga, unsur materi yang diperjanjikan, berupa kerja dan ujrah atau upah.

B.6. Jenis Ijarah Al Ijarah adalah suatu jenis akad untuk mengambil manfaat suatu barang dengan jalan penggantian. Beberapa contoh kontrak ijarah (pemilikan manfaat) seperti : 1. Manfaat yang berasal dari aset seperti rumah untuk ditepati, atau mobil untuk dikendarai. 2. Manfaat yang berasal karya seperti hasil karya seorang insinyur bangunan, tukang tenun, tukang pewarna, dll. 3. Manfaat yang berasal dari skill/keahlian individu seperti pekerja kantor, pembantu rumah tangga, guru, dll. Sementara itu, menyewakan pohon untuk dimanfaatkan buahnya, menyewakan makanan untuk dimakan, dll bukan termasuk kategori ijarah karena barang-barang tersebut tidak dapat dimanfaatkan kecuali barang-barang tersebut akan habis dikonsumsi. Menurut Sayyid Sabiq, Ijarah adalah suatu jenis akad yang mengambil manfaat dengan jalan penggantian. Dengan demikian pada hakikatnya ijarah adalah penjualan manfaat yaitu pemindahan hak guna (manfaat) atas suatu barang dan jasa dalam waktu tertentu melalui pembayaran sewa/upah tanpa diikuti dengan pemindahan kepemilikan barang itu sendiri. Akad ijarah tidak ada perubahan kepemilikan tetapi hanya perpindahan hak guna saja dari yang menyewakan kepada penyewa. [5].

B.6.1. Dalam Hukum Islam ada dua jenis ijarah, yaitu : a.

Ijarah yang berhubungan dengan sewa jasa, yaitu mempekerjakan jasa seseorang dengan upah sebagai imbalan jasa yang disewa. Pihak yang mempekerjakan disebut mustajir, pihak pekerja disebut ajir dan upah yang dibayarkan disebut ujrah. b. Ijarah yang berhubungan dengan sewa aset atau properti, yaitu memindahkan hak untuk memakai dari aset atau properti tertentu kepada orang lain dengan imbalan biaya sewa. Bentuk ijarah ini mirip dengan leasing (sewa) pada bisnis konvensional. Pihak yang menyewa (lessee) disebut mustajir, pihak yang menyewakan (lessor) disebutmu’jir/muajir dan biaya sewa disebut ujrah. Ijarah bentuk pertama banyak diterapkan dalam pelayanan jasa perbankan syari’ah, sementara ijarah bentuk kedua biasa dipakai sebagai bentuk investasi atau pembiayaan di perbankan syari’ah. [5]. B.6.2. Hukum Ijarah Ijarah sebagai suatu transaksi yang sifatnya saling tolong menolong mempunyai landasan yang kuat dalam al-Qur’an dan Hadits. Konsep ini mulai dikembangkan pada masa Khlaifah Umar bin Khathab yaitu ketika adanya sistem bagian tanah dan adanya langkah revolusioner dari Khalifah Umar yang melarang pemberian tanah bagi kaum muslim di wilayah yang ditaklukkan. Dan sebagai langkah alternatif adalah membudidayakan tanah berdasarkan pembayaran kharaj dan jizyah [6]. 2.7. Dasar Hukum 2.7.1. Kebolehan transaksi ijarah didasarkan Al Qur’an dan haditsQS. Al-Qashash ayat 26 27 :

Artinya : Salah seorang dari kedua wanita itu berkata: Ya bapakku ambillah ia sebagai orang yang bekerja 21

(pada kita), karena sesungguhnya orang yang paling baik yang kamu ambil untuk bekerja (pada kita) ialah orang yang kuat lagi dapat dipercaya. (28-26). Berkatalah dia (Syu’aib) : ”Sesungguhnya aku bermaksud menikahkan kamu dengan salah seorang dari kedua anakku ini, atas dasar bahwa kamu bekerja denganku delapan tahun dan jika kamu cukupkan sepuluh tahun maka itu adalah (suatu kebaikan) dari kamu, maka aku tidak III. hendak memberati kamu. Dan kamu insya Allah akan mendapatiku termasuk orang-orang yang baik. (28-27). Tafsir Musa bertemu dua wanita kakak beradik yang kesulitan memberi minum dombanya dari sumur, karena dihalangi orang-orang. Orang-orang itu setelah memberi minum pada domba mereka kemudian menutup sumur dengan batu-batu yang hanya bisa diangkat oleh sepuluh orang laki-laki. Musa kemudian menolong mereka dengan mengangkat batu-batu itu agar wanita itu bisa memberi minum domba mereka. Musa sangat kelaparan dan keletihan dalam perjalanannya itu. Wanita kakak beradik itu kemudian memberitahu mengenai Musa kepada ayah mereka yang telah tua renta, dan ayah mereka menyuruh keduanya untuk memanggil Musa untuk menemuinya. Orang tua itu meminta Musa untuk bekerja kepadanya menggembalakan ternak domba selama 8 tahun dan sebagai upahnya adalah menikahi salah satu dari kedua anaknya. Setelah delapan tahun Musa diberi kebebasan untuk tidak bekerja lagi padanya, namun apabila Musa menggenapkannya menjadi 10 tahun maka itu merupakan kenaikan dari Musa. Menurut mahzab Hambali ayat ini menjadi dalil bagi sahnya pembayaran upah dengan makanan atau pakaian.

mereka minta dijamu kepada penduduk negeri itu, tetapi penduduk negeri itu tidak mau menjamu mereka, kemudian keduanya mendapatkan dalam negeri itu dinding rumah yang hampir roboh, maka Khidhr menegakkan dinding itu. Musa berkata: Jikalau kamu mau, niscaya kamu mengambil upah untuk itu.” (QS. 18:77)

III. METODE PENELITIAN

Penelitian ini merupakan penelitian pengembangan yang dilakukan dalam tiga tahap. Tahap pertama adalah penelitian pendahuluan dengan menggunakan metode pengumpulan data yaitu wawancara, observasi dan studi pustaka [7].Tahap kedua merancang bangun sistem pengolahan data penggajian guru menggunakan akad ijarah pada SMK SalafiyahSyafi’iyyah Pangkalan Jati, dan tahap ketiga uji coba hasil pengembangan web. Pada penelitian pengembangan ini ditujukan untuk merancang sistempengolahan data penggajianguru pada SMK SalafiyahSyafi’iyyah Pangkalan Jati, untuk mempermudah meng-update data dan menyajikan informasi yang akurat untuk tiap penggajian guru pada waktu yang diinginkan.

C.1. Metode Pengembangan Sistem

Merancangbangunsistempengolahan data penggajian guru menggunakan akad ijarahpada SMK SalafiyahSyafi’iyyahPangkalanJatiini, penulis menggunakan model pendekatan RAD(Rapid Application Development) yakni pendekatan melalui tiga tahap untuk menganalisis dan merancang sistem dimana sistem tersebut dikembangkan melalui penggunaan siklus kegiatan penganalisis dan pemakai secara spesifik.

Tahap-tahap RAD yang dilakukan, yaitu : QS. Al-Kahfi: 77 Artinya : ”Maka keduanya berjalan; hingga tatkala keduanya sampai kepada penduduk suatu negeri, 22

1. Perencanaan Syarat-syarat Di tahap pertama dari siklus RAD ini, dilakukan identifikasi masalah, peluang, dan tujuan-tujuan yang hendak dicapai, dari merancangbangunsistempengolahan data

penggajian guru menggunakan akad ijarahpada SMK SalafiyahSyafi’iyyahPangkalanJatiini.Dalam tahap ini, penganalisis memasukkan apa saja yang menentukan syarat-syarat informasi untuk para user yang terlibat. Pada tahap ini, penulis melakukan wawancara pada pihak-pihak yang terkait untuk mendapatkan informasi-informasi yang dibutuhkan.Untuk tahap berikutnya ialah menganalisis kebutuhan-kebutuhan sistem. Dalam tahap ini perangkat-perangkat dan teknik-teknik tertentu akan membantu penganalisis menentukan kebutuhan.

Perencanaan Syarat-syarat

Mengidentifikasi Masalah, Peluang, dan Tujuan

Menentukan Syarat-Syarat Informasi Menganalisis Kebutuhan Sistem

Workshop Design

Perancangan Proses

Activity Diagram Usecase Diagram Sequence Diagram

Metode Pengembangan Sistem dengan RAD

2. Workshop Design Dalam tahap desain ini, dilakukan perancangan untuk aplikasi yang akan dibuat, yang terdiri dari :

Perancangan Database Class Diagram Mapping /LRS Analisis Data

a. Perancangan Proses menggunakan activity diagram, Usecase diagram dan sequence diagram, b. Perancangan Database menggunakanclass diagram beserta analisa datanya menggunakan teknik mapping class diagram untuk normalisasi serta spesifikasi database. c. Perancangan Antarmuka menggunakan STD (State Transition Diagram), serta perancangan form. 3. Fase implementasi Pada tahap ini dilakukan pengkodean terhadap rancangan-rancangan yang telah didefinisikan. Kemudian dibuat suatu dokumentasi berupa file ”Read Me”ataupun file ”Help” yang menjelaskan prosedur dari program.

Perancangan Infrastruktur dan arsitektur sistem

Normalisasi Spesifikasi Database

Perancangan Antarmuka

STD Form

Fase Implementasi

Mengembangkan dan Mendokumentasikan Perangkat Lunak

Menguji dan Mempertahankan Sistem

Gambar 3. Kerangka Berpikir

IV. Sebelum sistem informasi dapat digunakan, maka harus dilakukan pengujian terlebih dahulu. Beberapa pengujian dilakukan oleh programmer sendiri. Sebagian lagi dilakukan oleh sistem analis bekerjasama dengan programmer. Pada tahap ini dilakukan pengujian masing-masing modul (unit) program, apakah sesuai dengan tugasnya. Pengujian pada awalnya dilakukan dengan data sampel, kemudian secara bertahap dilakukan dengan data aktual. Pengujian ini dilakukan dengan menggunakan metode Blackbox testing.

C.2. Kerangka Berfikir Penelitian Penyusunan laporan ini disusun melalui beberapa tahapan yang harus dilakukan. Adapun kerangka berpikir penelitian yang dilakukan pada penulisan laporan penelitian ini adalah sebagai berikut:

HASIL PENELITIAN DAN PEMBAHASAN Dalam merancangbangunsistempengolahan datapenggajian guru menggunakan akad ijarahpada SMK SalafiyahSyafi’iyyahPangkalanJatiini terdapat beberapa kebutuhan yang harus dipenuhi, antara lain: 1.

Kebutuhan fungsional dan Pemodelan UML Berdasarkan data dari wawancara dan observasi yang telah diperoleh sebelumnya. Kebutuhan fungsional dari merancangbangunsistempengolahan data penggajian guru menggunakan akad ijarahpada SMK SalafiyahSyafi’iyyahPangkalanJatiini, adalah guru sebagai user dapat melakukan input absen. Tata Usaha sebagai user bisa mengelola data guru, data pelajaran dan mengelola data gaji. Bagian keuangan sebagai user bisa mengecek absensi guru dan transaksi keuangan Dari kebutuhan fungsional di atas maka dengan menggunakan pemodelan UML dibuatkan use

23

case diagram, activity diagram, sequence diagram dan class diagram kebutuhan fungsional sistem seperti berikut:

b.

Class Diagram :

user +id_user +username +password +level

mata pelajaran +kode_mp +nama_mp +nip_guru

input

+add() +edit() +delete() +save()

1

1..*

+add() +edit() +delete() +save()

1 1 akses

guru

memproses 1..*

1..* Transaksi

data gaji +id_datagaji +nip_guru +id_user

a.

+add() +edit() +delete() +save()

Use case diagram Diagram yang dibuat terdiri dari tiga aktor, yaitu guru, bagiantata usaha dan bagian keuangan.

1 memproses

1

1

+id_transaksi +nota_transaksi +tgl_transaksi +id_user 1..* +nip_guru +periode dari 1 +periode ke +jumlah_gaji +jumlah_absen

memproses

+add() +edit() 1..* +delete() +save()

melakukan

+add() +edit() +delete() +save()

+nip_guru +nama_guru +tlp_guru +alamat_guru +password

melakukan

1

1

Absensi +id_absensi +nip_guru +tanggal_absensi +add() +edit() +delete() +save()

Gambar 5. Class Diagram <>

update data

<> logout

login

Manage Data User

<> manage data guru

laporan

tambah

<>

<> <> manage data pelajaran

<>

Tata Usaha

cetak data diri

simpan hapus

c.

Mapping Cardinalitas

absen <>

manage data gaji <>

<> laporan

cetak slip gaji

Cek absen guru

absensi

user

+id_absensi (PK) +tanggal absensi +nip_guru (FK)

+id_user (PK) +username +password +level +kode_mp (FK)

keuangan

<> Transaksi keuangan

<>

Tambah

guru

+add() +edit() +delete() +save()

Simpan

<>

id_user

kode_mp

Hapus

Gambar 4 Use Case Diagram

+add() +edit() +delete() +save()

id user

+id_data_gaji (PK) +nip_guru +id_user +id_absensii (FK) id_data_gaji

+add() +edit() +delete() +save()

Gambar 6. Mapping Cardinalitas

24

id_absensi

data_gaji

nip_guru transaksi +id_transaksi (PK) +nota_transaksi +tgl_transaksi +periode_dari +periode_ke +jumlah_gaji +jumlah_absen +id_user (FK) +nip_guru (FK) +id_data gaji (FK)

nip_guru

+add() +edit() +delete() +save()

mata_pelajaran +kode_mp +nama_mp +nip_guru

+nip_guru (PK) +nama guru +tlp_guru +alamat_guru +password +id_user (FK)

+add() +edit() +delete() +save()

+add() +edit() +delete() +save()

d. Implementasi Setelah tahap development selesai maka selanjutnya dilakukan implementasi sistem seperti interface berikut:

V.

KESIMPULAN DAN SARAN

E.1. Kesimpulan Berdasarkanhasilanalisisterhadapsistem yang telahberjalan, masalah yang dihadapisertasistem yang diusulkanuntukmengatasimasalahtersebut, makadapatdisimpulkansebagaiberikut: 1. Sistem penggajian pada SMK Salafiyah Syafi’iyyah Pangkalan Jatimasih menggunakan system manual sehingga tidak efektif dan tidak efisiensi untuk menghasilkan informasi yang dibutuhkan. 2. Sistem yang berjalan saat ini belum dapat memudahkan bagian Tata Usaha (TU) dalam membuat laporan yang dibutuhkan secara mudah, cepat, akurat, danup to date. 3. Rancangansistempengolahan data penggajian guru menggunakan akad ijarahpada SMK SalafiyahSyafi’iyyahPangkalanJati,memberikan kemudahandalampemrosesandatanya, sehinggatidakterjadiperbedaan data danlebihefektifdalammendapatkandatanya. Datadata yang adapadapenggajian guru dapatdicetakdiantaranya, cetakdata guru, data matapelajaran, data gaji. Gambar 7 Display Web E.2. Saran 1. Sisteminimasih perludikembangkan lebih lanjut dari sistem informasi yang dirancang sehingga menjadi sistem informasi penggajian guru yang terpadu untuk menanggulangi dan mengolah data yang lebih besar. 2. Perlunyasistem keamanan penyimpanan data dan perlindungan dari pihak-pihak yang tidak berwenang.dan penelitian bisa menjadi acuan bagi peneliti selanjutnya. DAFTAR PUSTAKA [1].Sugiarti, Yuni. 2012. Hypertext Markup Language (HTML) Dikti Provinsi Banten. Buku Ajar. [2]. Swastika, Windra. 2006. PHP 5 dan MySQL 4. Jakarta: Dian Rakyat. Gambar 8Interface input absen guru

[3]. Whitten J.L., Bentley L.D., Dittman K.C. 2004. MetodeDesaindanAnalisisSistem. Yogyakarta: ANDI

25

[4]. Kendall, J. 2008. Sistem Analysis and Design. Seventh Edition. New Jersey : Pearson International Edition.

[5]. Muchlis Muhammad Hanafi. 2010. Biografi 5 Imam Mahzab. Jakarta :LenteraHati. [6]. Abdul AzisDahlan. 2005. EnsiklopediHukum Islam Jilid 4. IchtiarBaru Van Hoeve. [7].

Sugiarti, Yuni. 2010. Metode Penelitian di Bidang Komputer dan Sistem Informasi. Dikti Provinsi Banten. Buku Ajar.

COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benarbenar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

26

RANCANG BANGUN SISTEM INFORMASI PENGENDALIAN PERSEDIAAN BAHAN BAKU DAN HASIL PRODUKSI PADA PT GEMILANG SINERGITAMA MANDIRI Nia Kumaladewi1, Meinarini Catur Utami2, Iskandar Arrosyid3 Program Studi Sistem Informasi, Fakultas Sains dan Teknologi Universitas Islam Negeri Syarif Hidayatullah Jl. Ir. H. Juanda No. 95, Ciputat 15412 Jakarta E-mail : [email protected], [email protected] Abstract – PT Gemilang Sinergitama Mandiri (PT GSM) is a private company engaged in the printing industry by providing printing services of books and other print services. The production process is carried out by PT GSM is to produce prints that are tailored to demand and orders from consumers. Currently PT GSM not yet have a system that accommodates the exchange of information on all the company's business activities, especially in the operational divisions and their sub-divisions. Information systems are built aiming to improve process effectiveness in business processes so companies can improve service to consumers, as well as assist in managing both information as well as information on the operational activities of the company transaction information. Information system which will be applied constructed using prototype system development methods as well as using the EOQ (Economic Order Quantity) for determining the amount of raw materials to be ordered. Information system design using UML (Unified Modeling Language) as the tools used in describing the system to be built. Implementation of information systems that will be built is to use the PHP language and the end result is a web application that connects to a database which both run on a single server. Kata Kunci: Logistics Control, Production Control, EOQ A. PENDAHULUAN A. Latar Belakang Konsep produksi modern dewasa ini menganut prinsip orientasi pasar, dimana kegiatan produksi memiliki tujuan untuk memenuhi dan atau melampaui harapan konsumen. Oleh karena itu, proses produksi sendiri terletak diantara dua pasar, yaitu pasar masukan dan pasar keluaran [2]. Pasar masukan dapat diartikan sebagai pemasok bahan baku sedangkan pasar keluaran adalah konsumen atau pelanggannya. PT Gemilang Sinergitama Mandiri yang bergerak dalam bidang percetakan yang memiliki proses bisnis memproduksi buku cetak dan buku tulis. Selain proses produksi barang, PT Gemilang Sinergitama Mandiri juga memiliki kegiatan bisnis berupa proses logistik. Proses logistik yang dilakukan oleh perusahaan PT Gemilang Sinergitama Mandiri adalah dengan membeli bahan baku, menyimpan bahan baku dan menyediakan bahan baku yang nantinya dapat digunakan pada proses produksi. PT Gemilang Sinergitama Mandiri berdiri pda bulan Mei tahun 2012, dalam perjalanan bisnisnya masih berupaya untuk menjadikan seluruh proses bisnisnya dapat berjalan dengan baik khususnya pada proses bisnis yang berjalan pada kegiatan produksi dan logistik dengan mengurangi

banyaknya kesalahan dalam perkiraan logistik dan penggunaan bahan baku dalam proses produksi barang yang disesuaikan dengan permintaan pasar. Berbagai evaluasi dan monitoring yang dilakukan oleh perusahaan pada masing-masing proses bisnis didasarkan pada hasil kerja pada masing-masing proses bisnis, namun dalam beberapa waktu, setelah dilakukan proses audit terhadap ketersediaan bahan baku, ditemukan ketidaksamaan terhadap apa yang telah dilaporkan terhadap apa yang terjadi di dalam proses produksi yang terjadi. Ketidaksamaan tersebut berupa perbedaan nominal dari jumlah penggunaan dan kondisi dari bahan baku yang ada pada gudang. Ketidaksamaan tersebut tentu saja menjadi ancaman bagi perusahaan, akibat yang dapat terjadi adalah membengkaknya biaya penyediaan bahan baku yang tentu saja mengurangi laba dari perusahaan dan resiko perusahaan mengalami bangkrut menjadi lebih tinggi. Pada proses produksi, masalah akan sering muncul apabila tidak diatur oleh manajemen rantai pasok, diantaranya ketidakakuratan ketersediaan bahan baku, dan kemungkinan yang muncul bila hal tersebut terjadi adalah kekurangan bahan baku yang menyebabkan waktu pengerjaan yang terhambat, atau bahan baku yang berlebihan dan mengakibatkan banyaknya bahan baku yang tidak terpakai. Pada dasarnya PT Gemilang Sinergitama 27

Mandiri memahami akan fungsi dari perhitungan ketersediaan bahan baku tersebut, dan kesalahan pada perhitungan bahan baku yang diharapkan oleh PT Gemilang Sinergitama Mandiri adalah sebanyak 20%. Perhitungan tersebut diperoleh berdasarkan pengalaman dari manager operasional pada PT Gemilang Sinergitama Mandiri dengan mempertimbangkan harga beli bahan baku dan nilai ekonomis dari bahan baku tersebut. Namun dalam kurun waktu belakangan ini, kesalahan perhitungan yang dialami oleh perusahaan untuk ketersediaan bahan baku mulai tahun 2012 hingga awal tahun tahun 2013 rata-rata setiap proyek yang dikerjakan dapat menghasilkan nilai kesalahan perhitungan bahan baku rata-rata sebanyak 45%. Perhitungan dapat diamati pada besarnya bahan baku yang digunakan dalam dua proyek yang dikerjakan dapat dilihat dari tabel berikut: Tabel 1 Jumlah Bahan Baku pada Proyek Yayasan Mahardika (Sumber: PT Gemilang Sinergitama Mandiri, 2013) Nama Proyek

N N o

1

28

Estim asi / peng guna an baha n baku Estim asi baha n baku selam a proye k Baha n baku yang digun akan selam a proye k

Pengadaan buku tulis Yayasan Mahardika Hal am Cove an r isi buku buk u

Pengadaan buku cetak Yayasan Mahardika Cove r buku

Hala man isi buku

450 lemb ar

750 lem bar

45 lemb ar

170 lemb ar

500 lemb ar

800 lem bar

60 lemb ar

250 lemb ar

Dari uraian diatas, dapat diartikan perusahaan PT Gemilang Sinergitama Mandiri memerlukan sistem informasi yang baik dalam mengatur pengendalian persediaan dan hasil produksinya. Oleh karena itu penulis memilih untuk mengadakan penelitian yang bertemakan sistem informasi manajemen rantai pasok yang mengambil studi kasus pada PT Gemilang Sinergitama Mandiri, dan penelitian tersebut diberi judul “Rancang Bangun Sistem Informasi Pengendalian Persediaan Bahan Baku dan Hasil Produksi Pada PT Gemilang Sinergitama Mandiri”. B. Rumusan Masalah Melihat dari uraian pada poin latar belakang, terlihat identifikasi permasalahan yang ada saat ini adalah: 1. PT Gemilang Sinergitama Mandiri belum memiliki sistem informasi untuk menangani proses manajemen yang digunakan dalam kegiatan logistik dan produksi perusahaan khususnya permasalahan persediaan bahan baku dan hasil produksi yang memiliki ketidakakuratan dalam perhitungan ketersediaan barang. 2. PT Gemilang Sinergitama Mandiri belum memiliki aplikasi yang mengatur informasi pada proses logistik barang serta aplikasi yang merekap laporan secara digital yang dapat menghemat waktu pelaporan dari hasil kerja baik pada proses logistik dan produksi. C. Batasan Masalah Batasan masalah dibuat mengingat cukup besarnya cakupan pada materi penelitian ini agar nantinya penelitian ini berfokus pada masalah dan mencapai hasil yang maksimal, adapun batasan dari penelitian ini adalah: 1. Sistem membahas permasalahan pada kegiatan logistik dan produksi pada PT Gemilang Sinergitama Mandiri yang seluruh kegiatan bisnisnya terdapat pada divisi operasional dan aktor yang terlibat dalam sistem ini adalah pemasok, pegawai, direktur dan admin. 2. Metode yang digunakan pada perhitungan persediaan optimum menggunakan metode Economic Order Quantity (EOQ) dan tidak membahas sampai dengan proses re-order point. 3. Pengembangan sistem menggunakan metode prototyping dan aplikasi dibangun dengan menggunakan bahasa pemrograman PHP dan basis data MySQL, 4. Ruang lingkup pembuatan sistem informasi manajemen rantai pasok hanya pada proses pengontrolan logistik dan laporan hasil produksi, tidak termasuk modul keuangan, distribusi, penjualan dan karyawan. 5. Penelitian ini hanya sampai tahap implementasi pengujian sistem, tidak

6. 7.

8.

mencakup penerapan pada PT Gemilang Sinergitama Mandiri. Tidak mencakup keamanan aplikasi. Tidak mencakup perhitungan modul akuntansi yang berkaitan dengan harga barang yang masuk dan keluar. Sistem yang dibuat untuk membantu Management dan divisi Operasional yang mencakup kegiatan produksi dan manufakturing perusahaan diantaranya divisi PPIC, Gudang, Produksi dan Purchasing.

D. Tujuan Penelitian Tujuan dari penelitian ini dibagi menjadi 2 bagian, yaitu tujuan umum dan tujuan khusus. Tujuan umum dari penelitian ini adalah menghasilkan aplikasi sistem informasi pengendalian proses logistik dan produksi yang akan diimplementasikan pada PT Gemilang Sinergitama Mandiri, sedangkan tujuan khusus dari penelitian ini adalah: 1. Menganalisa sistem berjalan dan merancang sistem informasi pengendalian proses logistik dan produksi. 2. Membangun dan melakukan Implementasi sistem informasi pengendalian proses logistik dan produksi. B. LANDASAN TEORI A. Konsep Dasar Sistem Informasi Sistem informasi adalah pengaturan orang, data, proses dan tekonologi informasi yang berinteraksi untuk mengumpulkan, memproses, menyimpan dan menyediakan sebagai keluaran informasi yang diperlukan untuk mendukung sebuah informasi [1]. B. Konsep dan Pengertian Pengendalian Persediaan Persediaan (inventory) adalah sumber daya ekonomi fisik yang perlu diadakan dan dipelihara untuk menunjang kelancaran produksi, meliputi bahan baku (raw material), produk jadi (finish product), komponen rakitan (component), bahan pembantu (substance material) dan barang sedang dalam proses pengerjaan [2]. Dari penjelasan diatas, biaya persediaan (incremental cost) yang optimal akan tercapai pada titik keseimbangan antara biaya pemesanan dan biaya penyimpanan. Model biaya variabel untuk total persediaan adalah sebagai berikut [2]:

Gambar 1. Model Biaya Variabel C. Metode Economic Order Quantity Persediaan optimum akan dicapai pada titik keseimbangan antara biaya penyimpanan dan biaya pemesanan (titik keseimbangan pada gambar 2.2). Secara matematis, keseimbangan tersebut dapat dirumuskan melalui persamaan berikut:

Qopt = �

2𝐷𝐷𝐷𝐷 𝐻𝐻

Keterangan Rumus: Qopt D S H

: Persediaan Optimum : Kebutuhan Bahan per Tahun : Biaya Pesanan per Order : Biaya Penyimpanan per Tahun

Q opt sering disebut sebagai Economic Order Quantity (EOQ), yaitu jumlah unit yang dipesan pada biaya yang paling murah/optimal dan ekonomis. Asumsi yang dipertimbangkan diantaranya adalah [2]: 1. Permintaan selama satu tahun (D) diketahui tetap dan tidak berubah. 2. Harga sediaan (C) diketahui tetap dan tidak berubah. 3. Sediaan dianggap selalu tersedia sehingga dapat diperoleh setiap dibutuhkan. 4. Biaya sediaan diketahui tetap dan tidak berubah. D. Basis Data Basis data terdiri dari 2 kata yaitu Basis dan Data, basis dapat diartikan sebagai markas atau gudang, tempat bersarang/berkumpul dan data adalah representasi fakta dunia nyata yang mewakili suatu objek yang direkam dalam bentuk angka, huruf, simbol, teks, gambar atau kombinasinya. Jika dikombinasikan maka pengertian basis data adalah himpunan kelompok data (arsip) yang saling berhubungan yang diorganisasi sedemikian rupa agar kelak dapat dimanfaatkan kembali dengan cepat dan mudah dan disimpan dalam media penyimpanan elektronik [3]. E. SIstem Manajemen Basis Data Sistem manajemen basis data (DBMS) merupakan perangkat lunak sistem yang memungkinkan para pengguna untuk memakai, memelihara dan mengakses sumber daya dengan efisien (Mulyanto, 2009). Perangkat lunak yang menjalankan sistem manajemen basis data menyediakan fasilitas menambah, menghapus, memelihara, menampilkan, mencetak, mencari, 29

memilih, mengurutkan serta mempebaharui data (Turban et al, 2006 Sebuah sistem pengelola basis data (DBMS) umumnya memiliki sejumlah komponen fungsional (modul) seperti [3]: 1. File Manager: Mengelola alokasi ruang dalam media penyimpanan dan struktur data yang dipakai untuk merepresentasikan informasi yang tersimpan dalam media penyimpanan tersebut. 2. Database Manager: Menyediakan interface antara data low level yang ada pada basis data dengan program aplikasi query yang diberikan ke sistem. 3. Query Processor: Menerjemahkan perintahperintah dalam query language ke perintah low level yang dapat dimengerti oleh database manager. Query Processor juga akan mentransformasikan permintaan user ke bentuk yang lebih efisien yang menjadikan query menjadi lebih efektif. 4. DML (Data Manipulation Language) Precompiler: Mengkonversi perintah DML yang ditambahkan dalam sebuah program aplikasi ke pemanggilan prosedur normal dalam bahasa induk. Precompiler ini akan berinteraksi dengan query processor. 5. DDL (Data Definition Language) Compiler: Mengkonversikan perintah-perintah DDL ke dalam sekumpulan tabel yang mengandung metadata (data yang merepresentasikan data yang sesungguhnya). Tabel-tabel ini kemudian disimpan dalam kamus data. F. Website World Wide Web (WWW) atau yang biasa disebut dengan istilah web adalah sekumpulan protokol internet yang menyediakan informasi untuk pengguna dengan format hypertext [4]. G. PHP UML merupakan kesatuan dari bahasa PHP singkatan dari PHP Hypertext Preprocessor, yaitu bahasa berbentuk skrip yang ditempatkan pada server dan diproses oleh server, hasilnya-lah yang dikirimkan kepada klien, tempat pemakai menggunakan browser [5]. H. MySql MySQL adalah suatu sistem manajemen basis data relasional yang mendukung basis data yang terdiri dari sekumpulan relasi atau tabel [5]. I.

Konsep Sistem Berorientasi Objek Analisis sistem berorientasi objek didasarkan pada beberapa konsep dan konsep ini membutuhkan cara pemikiran baru untuk sistem dan proses pengembangannya [1], yaitu: 1. Objek: Adalah sesuatu yang ada atau dapat dilihat, disentuh atau dirasakan dan pengguna

30

2. 3.

4.

5.

menyimpan data serta mencatat perilaku mengenai sesuatu tersebut. Atribut: Adalah data yang mewakili karakteristik sebuah objek. Object Instance: Adalah setiap orang khusus, tempat, kejadian dan nilai untuk atribut dari objek. Tingkah laku: Adalah kumpulan dari sesuatu yang dapat dilakukan oleh objek dan terkait dengan fungsi-fungsi yang bertindak pada data objek (atau atribut). Pada siklus berorientasi objek, perilaku objek merujuk kepada metode, operasi atau fungsi. Package: Adalah pengemasan beberapa item ke dalam satu unit.

J.

UML Unifield Modeling Language (UML) adalah keluarga notasi grafis yang didukung oleh metamodel tunggal, yang membantu pendeskripsian dan desain sistem perangkat lunak, khususnya sistem yang dibangun menggunakan pemrograman berorientasi objek (Fowler, 2005). Dalam definisi lain menyebutkan pengertian UML adalah satu kumpulan konvensi pemodelan yang digunakan untuk menentukan atau menggambarkan sebuah sistem software yang terkait dengan objek [1]. C. METODOLOGI PENELITIAN A. Metode Pengumpulan Data - Observasi Observasi dilakukan dengan melihat langsung kegiatan bisnis yang berjalan pada PT Gemilang Sinergitama Mandiri, penelitian dilakukan dibawah bimbingan Ibu Yohanna selaku manajer HRD & Akunting. Observasi dilakukan pada tanggal 5 hingga 14 Maret 2013 dengan melihat kegiatan fisik dan mengamati proses pertukaran data dan informasi yang berjalan pada kegiatan logistik dan produksi di PT Gemilang Sinergitama Mandiri - Wawancara Wawancara dilakukan dengan mengajukan pertanyaan ke pihak terkait seputar proses manajemen rantai pasok pada PT Gemilang Sinergitama Mandiri, yaitu Ibu Yohanna sebagai pembimbing observasi dan Bapak Handoko selaku Manajer Operasional. Wawancara dilakukan pada 5 dan 14 Maret 2013 bertempat di PT Gemilang Sinergitama Mandiri. Tahapan wawancara menghasilkan informasi seputar kegiatan bisnis dan keterangan seputar profil perusahaan - Studi Literatur Studi literatur dilakukan dengan mempelajari dan memahami berbagai sumber bacaan yang berhubungan dengan penelitian seputar manajemen rantai pasok dan

persediaan bahan baku. Sumber bacaan tersebut diantaranya berasal dari jurnal, buku kajian maupun internet. Daftar buku dan website yang menjadi referensi pada penelitian ini dapat dilihat pada daftar pustaka. B. Metode Persediaan Metode persediaan optimum yang digunakan dalam menghitung persediaan bahan baku adalah dengan metode perhitungan Economic Order Quantity (EOQ) dengan terlebih dahulu mempertimbangkan dan mendefinisikan nilai-nilai berikut: - Kebutuhan bahan baku Mendefinisikan berapa jumlah bahan baku yang akan digunakan dalam kurun waktu satu tahun. - Biaya pesanan bahan baku Mendefinisikan nilai pembelian bahan baku. - Biaya penyimpanan Mendefinisikan nilai biaya penyimpanan pada masing-msing bahan baku. Nilai biaya penyimpanan bahan baku adalah 10% dari biaya pemesanan masing-masing bahan baku. Economic Order Quantity (EOQ) Nilai Economic Order Quantity (EOQ) dapat diperoleh dengan menggunakan rumus Qopt = �

2 𝐷𝐷𝐷𝐷 𝐻𝐻

dimana nilai D adalah nilai jumlah

permintaan bahan baku dalam satu tahun, S adalah nilai atau biaya pemesanan bahan baku dan H adalah biaya penyimpanan bahan baku. Metode persediaan optimum yang digunakan dalam menghitung persediaan bahan baku adalah dengan metode perhitungan Economic Order Quantity (EOQ) dengan mempertimbangkan kebutuhan bahan baku, biaya pesanan dan biaya penyimpanan dalam kurun waktu yang telah didefinisikan. C. Metode Pengembangan Sistem Adapun tahapan yang dilakukan pada metodologi pengembangan sistem yang menggunakan metode prototipe adalah: 1. Pengumpulan Kebutuhan Pada tahapan ini dilakukan kegiatan berupa mendefinisikan masalah dan batasan yang digunakan dalam pengembangan sistem. Pada tahapan ini kegiatan lainnya adalah menggambarkan masalah dan kesempatan serta perintah yang mempengaruhi pengembangan sistem ini. Dengan memperhatikan permasalahan, ruang lingkup, kesempatan dan perintah maka dapat diketahui seberapa besar penelitian dari sistem informasi ini. 2. Perencanaan a. Perancangan Proses Tahapan ini bertujuan untuk memodelkan sistem yang nyata dengan penekanan pada apa

yang harus dilakukannya. Hasil dari tahapan ini adalah pemahaman sistem seutuhnya sebagai dasar pembuatan prototipe. Metode yang digunakan pada tahap ini adalah analisis berorienatsi objek dan pemodelan menggunakan rich picture sebagai gambaran untuk menjelaskan model dari sistem dengan melukiskan seluruh kepentingan stakeholder dan struktur utama dari konteks kerja pada organisasi bisnis. Alat yang digunakan untuk membantu tahapan perancangan sistem ini adalah UML (Unified Modeling Language). Diagram UML yang digunakan untuk perancangan ini diantaranya adalah: i. Use case diagram ii. Diagram aktivitas iii. Diagram sekuensi iv. Statechart diagram v. deployment diagram b. Perancangan Basis Data Tahapan ini bertujuan untuk memilih dan menentukan potensi-potensi data yang dapat digunakan pada sistem, diagram yang digunakan untuk menggambarkan tahap perencanaan basis data adalah: i. Class Diagram ii. Perancangan Basis data yang mencakup normalisasi, skema basis data dan struktur basis data. 3. Perancangan antarmuka Tahapan ini menggambarkan gambaran kasar dari aplikasi yang digunakan pada sistem. Perancngan antarmuka berisi gambar dan keterangan yang menjelaskan secara visual bagaimana nanti aplikasi yang akan diimplementasikan. 4. Implementasi Pemrograman Menerapkan hasil desain ke dalam baris kode pemrograman baik rancangan basis data maupun bahasa komputer menggunakan perangkat lunak mySql untuk mengelola basis data serta software adobe dreamweaver untuk pemrograman aplikasi dengan bahasa HTML dan PHP.

5.

Instalasi Perangkat Instalasi software dan hardware dengan aplikasi yang telah dibangun agar aplikasi dapat berjalan dengan benar sesuai dengan yang diharapkan. 6. Evaluasi Prototipe Melakukan pengujian dari output/keluaran dari aplikasi yang telah diimplementasikan. Pada tahapan ini peran pengguna sangat dibutuhkan untuk mengetahui dan mengevaluasi aplikasi yang telah dibangun. D. Kerangka Penelitian Dalam melakukan penelitian ini, peneliti melakukan tahapan-tahapan kegiatan dengan mengikuti rencana kegiatan yang tertuang dalam 31

kerangka penelitian meliputi metode pengumpulan data dan metode pengembangan sistem. Berikut ini dapat dilihat gambaran kerangka berpikir penelitian.

PT Gemilang Sinergitama Mandiri memiliki visi “Menjadi perusahaan percetakan dengan menciptakan karya cetak berkualitas melalui kreasi, solusi dan inovasi” dan misi yang dijalankan oleh PT Gemilang Sinergitama Mandiri adalah: 1. Mengutamakan kepuasan pelanggan. 2. Melakukan proses yang maksimal dalam pencetakan. 3. Memaksimalkan ketepatan dan kecepatan waktu. 4. Memberikan mutu yang berkualitas. 5. Menciptakan sebuah inovasi demi terciptanya nilai baru bagi produk. B. Metode Persediaan Metode persediaan optimum dapat ditentukan dengan terlebih dahulu mendefinisikan jumlah permintaan (dalam kurun waktu satu tahun), biaya pemesanan pada setiap pembelian bahan baku dan biaya penyimpanan bahan baku (dalam kurun waktu satu tahun). Dari keseluruhan proyek yang dikerjakan oleh PT Gemilang Sinergitama Mandiri, diperoleh tabel yang mendefinisikan bahan baku yang digunakan pada kurun waktu satu tahun terhitung mulai dari Agustus 2012 sampai dengan April 2013. Tabel 2. Jumlah Unit Bahan Baku (Sumber: PT Gemilang Sinergitama Mandiri, 2013) Nama Unit Unit No Produk bahan bahan baku baku untuk untuk cover isi buku

Gambar 1. Kerangka Penelitian

IV.

Gambar 2. Logo Perusahaan PT Gemilang Sinergitama Mandiri

32

Buku tulis

800 lembar

1500 lembar

2

Buku cetak

90 lembar

250 lembar

Dari tabel diatas diperoleh nilai untuk mendefinisikan rumusan persediaan optimum, nilai tersebut adalah:

HASIL DAN PEMBAHASAN

A. Gambaran Umum Perusahaan

1

1.

Asumsi jumlah permintaan buku tulis (dalam kurun waktu satu tahun): lembar a. 8009 𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏 x 12 bulan = 1.067 (cover buku tulis) lembar b. 1500 x 12 bulan = 2.000 (isi buku 9 𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏 tulis) lembar c. 909 𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏 x 12 bulan = 120 (cover buku cetak) d. 250 lembar x 12 bulan = 334 (isi buku cetak) 9 𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏𝑏

2. i. ii. iii. iv.

Biaya pemesanan bahan baku pada setiap order: Cover buku tulis : Rp. 32.000 Isi buku tulis : Rp. 28.000 Cover buku cetak : Rp. 30.000 Isi buku cetak : Rp. 25.000

i. ii. iii. iv.

Biaya penyimpanan bahan baku (10% dari harga pemesanan) Cover buku tulis : Rp. 3.200 Isi buku tulis : Rp. 2.800 Cover buku cetak : Rp. 3.000 Isi buku cetak : Rp. 2.500

Gemilang Sinergitama Mandiri baik pada level operasional maupun manajerial, dengan dibuatkannya sistem informasi manajemen nantinya diharapkan segala proses administrasi pada PT Gemilang Sinergitama Mandiri dapat terakomodir dengan baik dan pengotrolan proses produksi dan pengendalian bahan baku dapat dijalankan secara maksimal. Sistem informasi yang diimplementasikan pada suatu aplikasi harus mengakomodir pekerjaan-pekerjaan yang ada

Biaya Persediaan Bahan Baku 2 𝐷𝐷𝐷𝐷

Rumus : Qopt = �

𝐻𝐻

32.000 a. Qopt = �2 𝑥𝑥 1.067𝑥𝑥 = 146 3200

𝑥𝑥 28.000 b. Qopt = �2 𝑥𝑥 2000 = 200 2800 𝑥𝑥 30.000 c. Qopt = �2 𝑥𝑥 1203000 = 49 2 𝑥𝑥 334 𝑥𝑥 25.000

d. Qopt = �

2500

= 82

Dari perhitungan persediaan optimum diatas, diperoleh nilai yang dapat digunakan sebagai parameter bagi perusahaan untuk mendefinisikan jumlah bahan baku yang disediakan pada setiap proses pemesanan bahan baku, nilai tersebut adalah:

Gambar 3. Rich Picture Sistem Berjalan PT Gemilang Sinergitama Mandir

2) Sistem Usulan Sistem usulan yang diberikan dari permasalah pada poin identifikasi masalah adalah dengan diterapkannya sebuah sistem yang mengatur alur dari seluruh transaksi gudang dan proses produksi yang terjadi pada PT Gemilang Sinergitama Mandiri. Sistem yang dibangun juga mengatur informasi yang ada pada proses bisnis PT

Gambar 4. Analisis Sistem Usulan 3) Usecase Diagram Pada tahap ini terdapat beberapa hal yang harus dikerjakan, yaitu : - Penentuan Aktor - Identifikasi Usecase Diagram,

Gambar 5. Usecase Diagram 4) Narasi Usecase Diagram Usecase scenario merupakan penjelasan yang lebih terperinci mngenai masing-masing usecase yang terjadi di dalam sistem. Usecase diagram terdiri dari: - Nama usecase : Nama usecase yang akan dideskripsikan - Actor : Aktor yang terlibat - Trigger : Tujuan dari usecase - Pre condition : Syarat penting bagi usecase untuk memulai

33

-

-

Description : Mendeskripsikan actor dalam menjalankan sistem Typical course of events : Kegiatan yang dilakukan oleh usecase Alternate courses : Kegiatan alternatif lain saat sistem merespon Conclusion : Kesimpulan dari kegiatan sistem Post condition : Kegiatan setelah usecase selesai dikerjakan

Contoh narasi usecase diagram login dapat dilihat pada tabel 2.

Condition

user.

5) Activity Diagram Activity diagram menggambarkan alur kerja (work flow) sebuah urutan aktivitas pada suatu proses. Diagram ini sangat mirip dengan flowchart karena dengan activity diagram dapat memodelkan proses logika, proses bisnis dan alur kerja. Perbedaan utamanya adalah flowchart dibuat untuk menggambarkan alur kerja dari sebuah sistem, sedangkan activity diagram dibuat untuk menggambarkan aktivitas actor. mulai input username dan password

Use Case name Use Case id Actor Descripti on

Pre Condition Trigger Typical course of events

Alternate Course

Conclusio n Post 34

Tabel 2. Narasi Usecase Login Login

verifikasi username dan password

data valid

1 ALL Menggambarkan proses user melakukan input username dan password untuk dapat melakukan akses terhadap aplikasi. user membuka aplikasi aplikasi informasi pengendalian bahan baku dan hasil produksi. Use Case ini dilakukam agar aktor dapat mengakses sistem. Actor Action System Response 1. Menampilk an form login. 2. Memasuk 3. Cek an username, username password. dan password. 4. Menampilk an halaman utama aplikasi sistem informasi pengendalia n bahan baku dan hasil produksi. 3. Jika user salah dalam memasukan usernamae dan password, maka aplikasi akan mengembalikan aplikasi pada form login. Data berhasil ter-input. Data login diambil di dalam tabel

data tidak valid

mengakses halaman utama

selesai

Gambar 6. Activity Diagram

6) Class Diagram Class diagram menggambarkan kelaskelas objek yang menyusun sebuah sistem dan juga menghubungkan antara kelas objek yang terjadi di dalam sistem informasi pelayanan haji dan umroh berbasis web.

DetailChat +idDetailchat +idChat +to +isi +waktu +status

Chat 1

*

+idChat +user1 +user2 +Create() +Read() +Delete()

* 1 UserType

*

1

+idUsertype +nama

1

User +idUser +username +password +email +idUsertype

DetailPasport +idDetailpassport +idPassport +no_ktp

Passport 1

*

CekKesehatan

Jamaah

+idPegawai +idUser +namalengkap +alamat

+idUser +no_ktp 1 +no_passport +namalengkap +ayah +tempat_lahir +tanggal_lahir +umur +jenis_kelamin +rambut +alis +hidung +muka +tinggi +berat_badan +pendidikan 1 +pekerjaan +warga_negara +alamat +kelurahan +kecamatan +kabupaten +propinsi +kode_pos +no_telp * +gol_darah +status +foto +pernah_haji_umroh +nama_mahram +hub_mahram

+Input() +Read() +Update() +Delete() +Search() +Cetak()

*

*

+idCekkesehatan +jenis_pemeriksaan +waktu_pemeriksaan_mulai +waktu_pemeriksaan_selesai +tempat_pemeriksaan +tanggal_pemeriksaan +created_at +updated_at

1

+idDetailcekkesehatan +idCekkesehatan +idTransaksi

+idTransaksi * +no_ktp 1 +no_spph +layanan +tahun_keberangkatan +bulan_keberangkatan +status_jamaah +paket +kamar +total_biaya +status +Input() +Delete() +Read() *

+Input() +Read() +Update() +Delete() +Search() +Cetak()

*

Pembayaran +idPembayaran +idTransaksi +no_ktp +tanggal +total +status +Input() +Delete() +Read() +Cetak()

Bimbingan +idBimbingan +tanggal_bimbingan +waktu_bimbingan_awal +waktu_bimbingan_akhir +tempat_bimbingan +nama_pembimbing

*

Admin dan database

DetailCekKesehatan

Transaksi

+Read() +Update() +Delete() +Search() +Cetak()

FrontOffice

+id +desc +value +type

+Input() +Read() +Update() +Delete() +Search() +Cetak()

1 Pegawai

GenericMaster

+idPassport +tanggal_pembuatan +waktu_pembuatan_awal +waktu_pembuatan_akhir +tempat_pembuatan +created_at +updated_at

1

+Input() +Read() +Update() +Delete() +Search() +Cetak() Article

1 KepalaSekretariat

1

Keuangan

+idArticle +judul +isi +type +created_by +created_at +created_updated

* 1

Ketua

+Input() +Update()

1

* *

*

Pengeluaran +idPengeluaran +tanggal +unit +harga_satuan +volume +harga_total +Input() +Update() +Delete() +Search()

Gambar 6. Class Diagram

mempermudah proses bisnis pada divisi operasional PT Gemilang Sinergitama Mandiri khususnya pada pengelolaan data bahan baku dan hasil produksi. c. Dengan adanya sistem pengendalian bahan baku dan hasil produksi ini, diharapkan kedepannya divisi operasional pada PT Gemilang Sinergitama Mandiri mendapatkan informasi yang lebih akurat karena menggunakan sistem informasi yang lebih terkomputerisasi dalam pengarsipan dan pengelolaan datanya. d. Dengan adanya sistem pengendalian bahan baku dan hasil produksi ini, diharapkan kedepannyadapat bermanfaat dan meningkatkan produktifitas dari perusahaan, mempercepat segala proses dokumentasi bisnis perusahaan serta mempermudah proses pengontrolan terhadap stok barang.

7) Sequence Diagram All Actor

Login Processor

1 : input username dan password()

2 : validasi data()

3 : Login Gagal()

4 : Menampilkan pesan gagal()

5 : Login Berhasil()

6 : Menampilkan Halaman Utama()

Gambar 8. Sequence Diagram Gambar sequence diatas Sequence diagram login menjelaskan bahwa proses login pada sistem dilakukan oleh seluruh aktor/user. Halaman login muncul saat user membuka aplikasi, seluruh user memiliki satu username yang unik dan password. Username dan password ini yang digunakan untuk melakukan proses login dan masuk ke dalam halaman utama aplikasi. 8) Struktur Basis Data Struktur basis data pada sistem informasi usulan bersumber dari class diagram yang telah didefinisikan sebelumnya. salesOrder

Customer PK idCustomer

PK

idSO

nama alamat phone contact

FK1

idCustomer tanggal idBarang qty price total

FK2

FK1

PermintaanPembelian

idTransGd

PK

idPP

tanggal ref mutasi idBarang qty

FK1

idDivisi tanggal idBarang qty

FK1

barang

transaksiProduksi PK

transaksiGudang PK

PK idBarang

idTransProd tanggal jenisProduksi mutasi idBarang qty

nama satuan metode type qtymin qtymax

idPO

FK1 FK2

idSupplier idPP tanggal idBarang qty price total

FK3

divisi

divisi

user supplier

PK

username

FK1

password email nama idDivisi

PK idSupplier nama alamat phone contact

Gambar 9. Skema Basis Data 9) Implementasi Pemrograman Implementasi pemrograman merupakan pendefinisian dari hasil desain impelementasi pemrograman menggunakan bahasa PHP sebagai platform aplikasinya dan MySql sebagai impelementasi basis data. V.

1.

PK idDivisi

purchasing PK

VI.

KESIMPULAN

a. Penelitian dan pengembangan sistem pengendalian bahan baku dan hasil produksi ini dilakukan dengan menggunakan teknik prototipe yang terdiri dari pengumpulan kebutuhan informasi, perencanaan dengan menggunakan UML untuk perancangan sistem dan evaluasi prototipe untuk melakukan pengujian sistem. b. Adanya sistem pengendalian bahan baku dan hasil produksi ini diharapkan dapat

2.

SARAN

Berdasarkan hasil penelitian diatas, maka saran-saran yang dapat diberikan adalah sebagai berikut: Bagi perusahaan Pengembangan sistem pengendalian sistem bahan baku dan hasil produksi ini dapat memaksimalkan proses bisnis dan pengelolaan data pada bagian logistik dan produksi, oleh kerena itu dibutuhkan satu divisi untuk menunjang proses pembelian barang yang nantinya tidak bergantung lagi terhadap manager operasional. Pengembangan sistem pengendalian sistem bahan baku dan hasil produksi ini membutuhkan training lanjutan memaksimalkan penggunaan aplikasi sehingga tujuan dari penggunaan apliksi tersebut dapat lebih maksimal. Bagi penulis Sistem pengendalian bahan baku dan hasil produksi ini dapat dikembangkan dengan menggunakan metode lainnya sehingga dapat menghasilkan alur bisnis yang berbeda. Sistem pengendalian bahan baku dan hasil produksi ini dapat dikembangkan dengan menggunakan bahasa pemograman lainnya yang lebih sesuai dan relevant. REFERENSI [1] Whitten JL, Bentley LD, Dittman KC. 2004. System Analysis and Desain Methods. Diterjemahkan oleh: Tim Penerjemah Andi. Yogyakarta: Andi Offset [2] Haming M, Nurmuddin M. 2007. Manajemen Produksi Modern: Operasi Manufaktur dan Jasa. Bumi Aksara. Jakarta. [3] Fathansyah. 2007. Buku Teks Komputer: Basis Data. Bandung: Informatika

35

[4] Godbole A, Kahate A. 2009. Web Technologies TCP/IP Architecture and Java Programming. New Delhi: McGraw-Hill. [5] Kadir A. 2002. Pengenalan Sistem Informasi. Yogyakarta: Andi Offset.

COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benar-benar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

36

ANALISA DAN PERANCANGAN SISTEM INFORMASI INVENTORI PRODUK NON-BBM PT. PERTAMINA (PERSERO) Gladly C. Rorimpandey [email protected] Program Studi Pendidikan Teknologi Informasi dan Komunikasi Fakultas Teknik Universitas Manado

Abstract - Unit Sales VII of PT. Pertamina (Persero) in Bitung Area is one of the Area which place for giving service for the North Sulawesi, the Gorontalo and the Middle Sulawesi (Except Palu). In addition to the fuel distributor, the company also markets products of non-fuel such as lubricants, LPG, Chemical Agriculture and so on. However, in the process of storage of non-fuel products, there are several problems such as the data collection process takes a long time because it is done manually which is written on the card type 50, the reporting process becomes cumbersome and often inaccurate because the product data to be reported should be included one by one in a spreadsheet. The purpose of this study is to analyze and design information systems Inventory Products Non-fuel that can help PT. Pertamina (Persero) UPMS VII Depot Bitung in controlling inventory goods and preparation of non-fuel products to improve the performance of the company. By using SDLC systems development methodologies and data modeling tools ERD and DFD Inventory Information System can then be analyzed and designed. Keywords: Inventory Information System, PT. Pertamina, SDLC (System Development Life Cycle), ERD(Entity Relationship Diagram), DFD (Data Flow Diagram).

I.

PENDAHULUAN

Latar Belakang Masalah PT. PERTAMINA(Persero) adalah salah satu perusahaan milik negara yang bergerak di bidang perminyakan. Untuk kelancaran pendistribusian minyak di seluruh daerah di Indonesia, maka PT. PERTAMINA (Persero) memiliki depot-depot sebagai sarana penimbunan & penyaluran Bahan Bakar Minyak (BBM). PT. Pertamina (Persero) Unit Pemasaran (UPms) VII Depot Bitung merupakan salah satu depot yang ditempatkan untuk melayani daerah Sulawesi Utara (SULUT), Gorontalo dan Sulawesi Tengah (Kecuali Palu). Selain sebagai penyalur BBM, perusahaan ini juga memasarkan produk-produk non-BBM seperti pelumas, LPG, Kimia Pertanian dan sebagainya. Namun, dalam proses penyimpanan produk nonBBM terdapat beberapa masalah seperti pada proses pendataan data yang memakan waktu cukup lama karena dilakukan secara manual yang ditulis pada Jenis Kartu 50, proses pembuatan laporan menjadi rumit dan seringkali tidak akurat karena data produk yang akan dilaporkan harus dimasukkan satu per satu dalam spreadsheet. Masalah yang lain juga dialami oleh pihak pelanggan yang akan membeli produk harus

menunggu lama untuk mendapatkan informasi mengenai ketersediaan produk karena produk harus dicek satu per satu pada kartu stok, serta Unit Pemasaran di Makasar seringkali mengirim produk yang kurang tepat karena laporan yang dikirim oleh Depot Bitung tidak akurat sehingga terjadi kekosongan produk. Untuk pembuatan laporan bulanan ada juga masalah yang timbul yaitu kesulitan untuk mengkonversi jumlah produk yang masih tersedia dan yang sudah laku dalam bentuk satuan terkecil yaitu liter karena staf harus menghitung konversi secara manual. Berdasarkan masalah-masalah yang sudah diuraikan di atas, maka dapat dilihat bahwa PT.Pertamina (Persero) UPms VII Depot Bitung memerlukan sebuah sistem informasi untuk menangani inventori produk non-BBM dengan menggunakan sistem manajemen basis data. Identifikasi Masalah Berdasarkan uraian pada bagian latar belakang masalah, dapat diidentifikasikanbeberapa permasalahan sebagai berikut: 1) Proses pendataan produk non-BBM memerlukan waktu yang cukup lama;

37

2) Proses pembuatan laporan sangat rumit karena harus diisi secara manual dalam aplikasi spreadsheet; 3) Informasi untuk ketersediaan produk bagi pelanggan memerlukan waktu yang cukup lama; dan 4) Penyaluran produk dari unit pemasaran di Makasar tidak tepat guna karena laporan permintaan yang dikirim tidak sesuai stok yang ada. Rumusan Masalah Berdasarkan pada uraian latar belakang, maka masalah dalam penelitian ini adalah bagaimana menganalisis dan merancang suatu sistem informasi inventori yang dapat membantu pelanggan untuk mendapatkan pelayanan yang cepat dengan informasi yang akurat, dan dapat mengontrol persediaan produk non-BBM yang ada di Depot Bitung, serta dapat menghasilkan laporan yang lengkap untuk Unit Pemasaran? Ruang Lingkup dan Batasan Masalah Untuk objectives lihat pada bagian ‘Manfaat Penelitian’ di halaman 3. Untuk scopes atau ruang lingkup dari penelitian ini adalah sebagai berikut: 1) Mencari informasi tentang produk-produk dan pelayanan yang ditawarkan oleh perusahaan. 2) Menganalisis masalah-masalah dan kesempatan-kesempatan yang dapat terjadi dalam penanganan inventori non-BBM 3) Merancang dan membuat antarmuka, basis data, dan algoritma. 4) Melakukan uji coba pada sistem yang akan dibangun 5) Fitur-fitur yang terdapat dalam pembuatan sistem informasi ini adalah: a. Form-form: - Form Log In dan Log Out - Form Pelanggan - Form Staf - Form Jenis Produk - Merek - Satuan (Unit) - Form Golongan - Form Produk - Form Penerimaan Produk Form Pemesanan Produk Form Penjualan Form Penyerahan Produk Form Pengembalian Pelanggan Form Pengembalian ke Unit Konversi Mutasi (Penyesuaian stok) b. Laporan:  Laporan Penerimaan  Laporan Penyerahan  Laporan Pemesanan 38

 

Laporan Pengembalian Pelanggan Laporan Pengembalian ke Unit

Penelitian ini memiliki batasan masalah, yaitu sebagai berikut: 1) Tidak membahas jaringan 2) Tidak membahas persediaan barang di luar produk non-BBM yang termasuk dalam Jenis Kartu 50 (JK-50) 3) Hanya untuk kalangan UPms VII Depot Bitung 4) Laporan yang dihasilkan oleh sistem baru tidak dalam bentuk grafik 5) Perhitungan biaya transportir pada pengiriman barang tidak dibahas dalam sistem. 6) Tidak akan membahas pembelian serta cara pembayaran pelanggan untuk produk non-BBM. 7) Tidak ada pemesanan produk dari Depot karena pada PT. PERTAMINA(Persero) yang berhak melakukan pemesanan hanya Unit Pemasaran. 8) Pemesanan produk serta jumlah pesanan ekonomis produk dari Depot tidak akan dibahas. 9) Tidak membahas pemeliharaan atau perawatan sistem.

Tujuan Masalah Tujuan dari penelitian ini adalah untuk merancang dan membangun sebuah sistem informasi inventori sehingga dapat membantu PT. Pertamina (Persero) UPms VII Depot Bitung dalam mengontrol persediaaan barang dan penyusunan laporan produk non-BBM untuk meningkatkan kinerja perusahaan. Manfaat Penelitian Beberapa manfaat yang diperoleh lewat penelitian ini, yaitu sebagai berikut: 1) Memudahkan pengontrolan, penerimaan, penyerahan bahkan pengembalian produk baik dari Depot ke Unit Pemasaran maupun pengembalian dari pelanggan ke Depot. 2) Membantu Depot Bitung untuk menyusun laporan bulanan supaya memudahkan Unit Pemasaran Makasar untuk mengadakan pemeriksaan.

II.

LANDASAN TEORI

Sistem Informasi Menurut Whitten, Bentley, Dittman “ Sistem informasi adalah pengaturan manusia, data, proses-

proses, antarmuka yang saling berinteraksi untuk mendukung kebutuhan penyelesaian masalah dan pengambilan keputusan oleh menajemen dan para pengguna.” (1) “Sistem informasi adalah suatu sistem yang menggunakan teknologi informasi untuk mengambil, menyalurkan, menyimpan, mengambil kembali, memanipulasi, atau menampilkan informasi yang digunakan untuk proses bisnis” (2) Sedangkan menurut Wilkinson (Wilkinson, 1993:14), “Sistem Informasi adalah suatu kerangka kerja dengan mana sumberdaya (manusia,komputer) dikoordinasikan untuk mengubah masukan (data) menjadi keluaran (informasi), guna mencapai sasaran perusahaan”. Jadi, dapat disimpulkan bahwa sistem informasi adalah kumpulan elemen yang saling berhubungan satu sama lain dengan memberikan masukan (data) untuk mendapatkan suatu keluaran (informasi) dengan fungsi untuk memproses, menyimpan, mendistribusikan informasi serta mendukung pengambilan keputusan. Information Systems

Operations Support Systems

Transaction Processing Systems

Process Control Systems

Management Support Systems

Enterprise Collaboration Systems

Management Information Systems

Decision Support Systems

Executive Information Systems

Gambar 1 Klarifikasi Sistem Informasi (1) Inventory Inventori adalah stok dari sejumlah produk atu sumber daya yang digunakan dalam kegiatan normal suatu organisasi atau perusahaan(3). Suatu sistem inventori adalah suatu rangkaian kebijakan dan kontrol untuk memonitor tahapan-tahapan inventori dan menentukan level mana yang harus ditangani ketika stok harus diisi kembali dan seberapa banyak yang harus dipesan.

Inventory Control “Inventory control adalah pengontrolan inventori atau persediaan dapat dicapai melalui penyimpanan data-data inventori dan laporan-laporan yang menyediakan informasi-informasi seperti penggunaan inventori, keseimbangan inventori serta tingkat minimum dan maksimum dari stok” (4). SDLC Metodologi SDLC terbagi dalam 6 tahapan yaitu: Feasibility, Analysis, Design, Implementation, Testing, Maintain. Tahap-tahap tersebut dapat digambarkan sebagai berikut(5):

Feasibility Analysis Design Implement Testing Maintain

Gambar 2 Tahapan Metodologi SDLC(1) III.

METODE PENELITIAN

Dengan mempertimbangkan ruang lingkup dan durasi waktu penelitian ini, maka metodologi pengembangan sistem yang digunakan untuk penelitian ini adalah System Development Life Cycle (SDLC).Adapun tahap-tahap yang akan dilaksanakan dalam penelitian ini adalah sebagai berikut: 1. Identifikasi Masalah adalah langkah awal pengerjaan sistem. Tujuannya untuk mengidentifiaksi masalah yang melatarbelakangi penelitian ini. 2. Penetapan Tujuan, langkah ini bertujuan untuk memutuskan tujuan penenlitian 3. Studi Literatur, dalam tahap ini peneliti melakukan kajian akan literatur-literatur yang dibutuhkan dalam pengembangan sistem. 4. Survey dan Pengumpulan Data, pada tahap ini peneliti akan melakukan survey tempat yang dijadikan objek dalam penelitian kemudian melakukan pengumpulan data dengan menggunakan metode sampling terhadap dokumentasi dan wawancara dengan teknisi yang terkait, juga mahasiswa dan orangtua mahasiswa. 5. Perencanaan Sistem, tahapan ini merupakan awal dalam mengembangkan sistem informasi. Dalam tahapan ini peneliti akan mengidentifikasi dan menganalisis kelayakan proyek, menentukan lingkup proyek, membuat rencana kerja. 6. Analisis Sistem, peneliti akan mempelajari sistem yang sedang berjalan berdasarkan masalah dan batasan yang telah ditetapkan, dengan membuat dokumantasi sesuai dengan tahapan dalam metodologi pengembangan sistem SDLC (System Development Life Cycle). 7. Perancangan Sistem, dengan berpedoman pada metodologi pengembangan sistem SDLC (System Development Life Cycle) peneilti akan melakukan langkah-langkah yang difokuskan pada pengspesifikasikan secara detail solusi yang berbasis komputer atau juga disebut perancangan yang bersifat fisik. 8. Penyusunan Rekomendasi, tahapan akhir yang bertujuan untuk memberikan rekomendasi yang berguna bagi implementasi sistem dan pengembangan sistem selanjutnya.

39

IV.

HASIL PENELITIAN

Tahap 1: System Initiation & Feasibility Study Masalah yang dihadapi perusahaan: Informasi jumlah produk non-BBM yang ada di gudang diperoleh dengan waktu yang cukup lama karena pendataan jumlah produk masih dilakukan secara manual dimana jumlah tersebut harus dimasukkan satu per satu pada spreadsheet yang jumlah produknya harus dikonversi secara manual. Rincian masalahnya adalah sebagai berikut: - Penerimaan, pendataan produk non-BBM yang baru diterima tidak teroganisir dengan baik sehingga untuk mendapatkan informasi penerimaan diwaktu yang lalu menjadi tidak efisien. - Produk, keunikan identitas setiap produk tidak ditunjukkan secara jelas pada jenis produknya, misalnya pada laporan yang dibuat produkproduk didaftar secara acak. - Pemesanan, informasi kepada pelanggan mengenai ketersediaan produk non-BBM yang akan dipesan membutuhkan waktu yang cukup lama dan membutuhkan tenaga karyawan yang banyak karena data produk harus diperiksa satu per satu di gudang. - Pengembalian ke Unit, produk-produk yang akan dikembalikan ke unit agak sulit dicari karena karyawan di gudang harus mencari satu per satu. - Laporan, karyawan gudang harus mendaftarkan satu per satu produk yang masih ada di gudang dan mengkonversi secara manual jumlah masing-masing produk dalam satuan terkecil yaitu liter. Study kelayakan (feasibility study) untuk penelitian ini adalah sebagai berikut Teknologi - Teknologi yang dibutuhkan untuk proyek ini sudah tersedia dan sesuai dengan keadaan perusahaan serta sistem informasi yang dikembangkan - Perangkat keras dan perangkat lunak yang yang dibutuhkan telah tersedia. - Sisetm yang dirancang memiliki respon yang cukup sesuai dengan keinginan dari klien. - Sistem ini bisa menjamin keamanan data karena dalam sisetm ini tesedia fasilitas login yang harus mengisi password. - Sistem yang akan dibangun terjamin keakuratanya. - Sistem ini dapat dikembangkan untuk kebutuhan yang lebih luas lagi. Operasi - Sistem yang dikembangkan memiliki dukungan dari manjemen dan user. - Sistem yang baru tidak akan mengubah situasi bisnis yang sudah berjalan - Tidak akan terjadi kehilangan data.

40

-

Data-data pelanggan tidak akan terpengaruh dengan adanya sistem yang baru. - Sistem informasi inventori yang akan dikembangkan merupakan sistem komputerisasi dengan menggunakan basis data yang dapat membantu perusahaan dalam memproses informasi menjadi lebih efisien dan mengurangi tingkat kesalahan dalam perhitungan stok yang ada di gudang. - Kemampuan untuk mengakases data pada sistem ini dapat dipertahankan. - Pihak perusahaan selaku pengguna akhir memberikan kesempatan pada tim proyek untuk membangun sistem informasi inventori yang dapat membantu perusahaan. - Dalam pengembangan sistem ini pihak perusahaan turut dilibatkan agar dapat dilakukan penyesuaian dengan sistem yang sudah ada. Sistem yang dikembangkan telah berbasis Graphic User Interface (GUI) sehingga dapat menghasilkan sistem yang user friendly. Ekonomi Penelitian ini memerlukan dana sekitar Rp. 10.000.000,- (Sepuluh juta rupiah) dengan perincian sebagai berikut: Tabel 1 Pembiayaan No Kegiatan Jumlah 1 Penyediaan Bahan Rp. 4.000.000,Material Penelitian (40%) 2 Biaya Transportasi Rp. 3.000.000,(30%) 3 Honorarium Tim Rp. 3.000.000,Pelaksana (30%) TOTAL Rp.10.000.000,Penjadwalan Penelitian ini dilakukan selama 3 bulan yaitu JuliAgustus. Tahap 2: Analysis Tabel 2Problem Statement Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat Peneri Data Kode maan mengena produk produk i produk yang dari yang diterima Unit diterima tidak Pemas tidak dicantum aran teroganis kan dan rincian ir produk dengan ditulis baik. secara acak sehingga

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah

Membangun sistem informasi inventori yang mampu memberi kode produk berdasarkan golongan dan jenis produknya.

Pengguna tidak dapat membuat kode produk sendiri karena kode produk akan ditampil kan secara otomatis

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat pada saat pembuat an laporan penerima an, penggun a harus menyusu n kembali data produk berdasar kan golongan dan jenis produk dan hal itu membut uhkan waktu yang cukup lama. Data Makin penerima hari data an waktu produk yang lalu yang sulit diterima untuk makin ditemuka banyak n. sehingga terjadi penumpu kan untuk JK-50 yang berisi data-data mengena i produk nonBBM yang diterima. Hal ini mengaki batkan penggun a harus mencari satu per satu data penerima an produk

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah oleh sistem setelah pengguna memilih golongan dan jenis produk.

Mengembangk an sistem yang terkomputerisa si sehingga memungkinkan pengguna untuk mendapatkan informasi yang lengkap dan cepat dangan fasilitas pencarian.

-

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat pada tumpuka n JK-50. Untuk Pada memasu sistem kkan lama data tidak penerima memiliki an proses produk, login sistem sehingga lama orang tidak yang memiliki tidak tingkat berhak keamana untuk n yang penerima tinggi. an bisa saja memanip ulasi data penerima an produk. Pemes Respon Ketersed anan untuk iaan pemesan produk an dari yang pelangga akan n lambat. dipesan harus dicek langsung di gudang karena tidak ada data yang akurat tentang persedia an produk. Sulit Lebih mengide banyak ntifikasi pemesan informas an dari i yang pelangga dibutuhk n maka nota an pelangga pemesan n untuk an makin memesa banyak n sehingga produk. karyawa n gudang harus

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah

Sistem yang akan dibangun dilengkapi dengan proses login dengan meningkatkan keamanan data dalam hal pengaksesan pengguna yang tepat.

-

Mengembangk an sistem informasi inventori yang dapat menginformasi kan persediaan produk digudang secara akurat dan terkini.

-

Mengembangk an sistem yang terkomputerisa si sehingga memungkinkan pengguna untuk mendapatkan informasi yang lengkap dan cepat dangan fasilitas pencarian.

-

41

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat mencari satu per satu pemesan an produk yang ada. Seringka Karyawa li terjadi n kesalaha membuat n kesalaha penulisa n dalam n untuk mendafta pemesan rkan an pesanan produk. produk sehingga menyeba bkan terjadi kerugian paa perusaha an Penyer Butuh Nota ahan waktu pesan yang yang lama ditulis untuk tidak mendapa teratur tkan nota dan pesanan disusun produk dengan yang baik akan sehingga diserahk pencaria an. nnya menjadi cukup sulit.

Terkadan g lupa untuk menulis karyawa n yang melakuk an penyerah an produk

42

Pada nota penyerah an tidak ada rincian karyawa n sehingga jika terjadi kesalaha n sulit untuk

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah

Mengembangk an sistem informasi inventori yang dapat mendaftarkan rincian pesan sehingga dapat mengurangi kesalahan.

-

Membangun sistem informasi inventori dengan menggunakan sistem manajemen basis data yang dapat menyediakan fasilitas pencarian berdasarkan golongan, jenis produk ataupun berdasarkan tanggal pemesanan Membangun sistem informasi inventori yang terkomperisasi yang dapat mengatur semua rincian karyawan yang menangani proses penyerahan.

-

Aplikasi ini tidak memuat data karyawan yang terperinci.

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat menentu kan karyawa n mana yang akan bertangg ung jawab. Penge Butuh Tidak mbalia waktu ada data yang n yang menyim produk lama pan ke untuk informas Unit mencari i tentang Pemas produk prouk aran yang cacat dan Makas harus ar dikembal tidak laku ikan sehingga karyawa n gudang harus memerik sa produk satu per satu di dalam gudang. Pengemb Data alian produk produk yang terkadan dikembal g ikan menjadi tidak lebih terorgani rumit. sir dengan baik, sehingga membut uhkan waktu yang lama untuk proses pengemb alian. Penge Proses Produk mbalia pengemb yang n alian akan produk produk dikembal dari dari ikan pelang pelangga harus gan ke n tidak didata Depot efisien. kembali

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah

Membangun sistem informasi inventori yang dapat menginformasi kan persediaan produk di gudang serta kondisi masing-masing produk

-

Dengan menggunakan aplikasi ini, proses pengembalian data menjadi lebih mudah.

-

Membangun sistem informasi inventori yang menyediakan data pengembalian produk dari

-

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat Bitung satu per satu pada JK-50 yang memuat data produk sebelum nya.

Pembu atan lapora n bulana n

Pembuat an laporan bulanan membut uhkan waktu yang cukup lama dan tidak efisien.

Kesulita n dalam mengkon versi jumlah produk yang akan dilapork an

Data produk yang masih tersedia, yang telah diserahk an dan yang dikembal ikan oleh pelangga n harus diisi satu per satu pada spreadsh eet sehingga pembuat an laporan memaka n cukup banyak waktu Jumlah produk yang diminta harus dalam satuan terkecil yaitu liter sehingga penggun a harus mengkon versi jumlah produk

Sistem yang Dikembangkan Pengembangan Sistem pelanggan yang berhubungan langsung dengan persediaan produk sehingga jumlah produk akan tertambah atau terkurang secara otomatis setelah rincian pengembalian di masukkan. Mengembangk an sistem informasi inventori dengan menggunakan manajemen basis data yang dapat menyimpan dan mengubah serta mengupdate data produk yang masuk dan keluar sehingga proses pembuatan laporan menjadi lebih mudah.

Membangun sistem informasi inventori yang dapat mengkonversi jumlah produk pada satuan terkecil dengan menyediakan form untuk konversi.

Batasan Masalah

-

-

Pengguna sistem Proses Analisa Sebab dan Akibat Masalah Sebab dan Akibat satu per satu

Sistem yang Dikembangkan Pengembangan Sistem

Batasan Masalah

Tabel 3 Prioritize Requirements Permintaan v / Alasan Prioritas x Sistem harus v Supaya sistem yang M terjamin dibuat tidk dapat diakses oleh orang yang keamanannya, yaitu dengan tidak berkepentingan menggunakan password. Membuat sistem v Supaya pimpinan depot M yang menghasilkan dan unit pemasaran laporan yang dapat mengontrol akurat tentang stok persediaan produk serta produk non-BBM unit dapat mengirimkan produk yang dibutuhkan oleh depot pada saat itu. Membuat warning x Agar stok produk di O untuk pemesanan Depot tidak akan habis ke pertamina disaat pelanggan akan pusat. memesan produk. Membuat sistem v Supaya laporan yang informasi inventori dikirim ke Unit sesuai dengan aturan yang yang menyediakan konversi jumlah diminta. stok pada satuan terkecil, yaitu: liter. Keterangan: M (Mandatory), D (Desirable), O (Optional) Tahap 3: Design Spesifikasi perangkat keras dan perangkat lunak untuk sistem baru adalah sebagai berikut: Tabel 4 Spesifikasi Perangkat Keras/Lunak Sistem Operasi: Windows XP Teknologi Basis MySql Data: Teknologi Borland Delphi 7.0 Perangkat Lunak: Resolusi layer : 1024 x 768 pixels - Motherboard yang mendukung Intel Pentium IV - Memori perangkat lunak minimal 20 GB Teknologi - Memory RAM 256 Perangkat Keras : MB atau lebih. - Mouse - Keyboard - Monitor - Printer

43

DFD Konteks

Deskripsi : 1) Username merupakan nama staff yg ada di tabel staff dan password ditentukan sendiri oleh user yg bersangkutan 2) Untuk masuk kedalam aplikasi, tekan tombol ‘Masuk’ atau menekan tombol Alt+’M’ pada keyboard. 3) Untuk keluar dari aplikasi, tekan tombol ‘Keluar’ atau menekan tombol Alt+’K’ pada keyboard.

Rincian nama_pengguna&password

Laporan penerimaan

Konfirmasi akses

Laporan penerimaan

Rincian laporan

Pengawas Keuangan

Rincian laporan

Kepala Depot

Laporan penerimaan Rincian pengembalian

Laporan pengembalian dari unit

Rincian nama pengguna&password

Unit Pemasaran

Rincian laporan

Konfirmasi akses

Hasil pengecekan

Rincian produk baru Jumlah produk dikonversi

Laporan penerimaan

Transportir

Produk dikonfirmasi Laporan rincian produk Daftar produk yang dikirim

SISTEM INFORMASI INVENTORI

Rincian produk Pengecekan kondisi produk Hasil pengecekan Laporan penerimaan

Produk yang dikembalikan Hasil laboratorium Rincian pesanan baru Konfirmasi produk Pesan divalidasi Pengecekan produk yang diserahkan Penyerahan produk disetujui Laporan penyerahan Konfirmasi hasil

Persediaan produk

Karyawan Gudang

Konfirmasi produk

Laporan pengembalianCO

Lapran pemesanan

Karyawan Lab

Page name : form Menu Utama Links from screen : form Log In Links to screen : form Profil, form Produk, form Laporan, form Bantuan, form Peta Letak, form Log In

Pelanggan

Produk penyerahan dicek Rincian penyerahan produk Validasi penyerahan Laporan penyerahan Rincian kondisi produk Rincian produk cacat Rincian produk pengembalian Pengembalian diperiksa Rincian pengembalian baru Laporan pengembalian CO & Unit

Gambar 3. DFD Konteks Perancangan Basis Data Golongan

mengalami dialami

Penyerahan

melakukan Dilakukan oleh

terdiri dari termasuk dalam

mengalami dialami oleh

memiliki dimiliki

terdiri dari termasuk dalam

Penerimaan

Konversi

Mutasi

JenisProduk

memiliki dimiliki oleh

termasuk dalam terdiri dari

Produk

memiliki dilmiliki oleh

mengalami dialami

ditangani oleh menangani

menangani

ditangani oleh

PengembalianUnit

PengembalianCO

mengalami dialami oleh

menangani ditangani oleh

Pemesanan

terdiri dari termasuk dalam

ditangani oleh

memiliki dimiliki oleh

dialami mengalami

menangani

dimiliki oleh memiiliki

melakukan Dilakukan oleh

Penjualan

Pelanggan

Staf menangani ditangani oleh menangani ditangani oleh

menangani ditangani oleh

ERD Konteks JenisProduk Konversi

Terdiri dari Termasuk dalam

Mutasi

Kode Satuan(pk)[Char[8]] Nama Satuan[VarChar[20]] Keterangan[VarChar[50]]

Kode_JenisProduk(pk)[Char[8]] Nama_JenisProduk[Varchar[20]] Merek[VarChar[20]] Keterangan[VarChar[50]]

memiliki dimiliki

Golongan Kode_Golongan(pk)[Char[8]] Nama_golongan[VarChar[20]] Keterangan[VarChar[50]]

Konversi

Dilakukan oleh

mengalami

Produk

terdiri dari termasuk dalam

memiliki dimiliki oleh

Kode_Penyerahan(pk)[Char[8]] Kode_Pelanggan(fk)[Char[8]] Kode_Staf(fk)[Char[8]] Kode_Pemesanan(fk)[Char[8]] Tanggal[VarChar[8]] Keterangan[VarChar[50]]

terdiri dari termasuk dalam

Kode_Staf(pk)[Char[8]] Nama Staff[VarChar[25]] Telp[VarChar[15]] Alamat[VarChar[50]] Kota[VarChar[15]] Password[VarChar[15]]

Penjualan

menangani ditangani oleh

Pemesanan Kode_Pemesanan(pk)[Char[8]] Kode_staf(fk)[Char[8]] Kode_Pelanggan(fk)[Char[8]] Status[VarChar[15]]

menangani ditangani oleh

PengembalianCO Kode_PengembalianCO(pk)[char[8]] Kode_Pemesanan(fk)[char[8]] Kode_Pelanggan(fk)[char[8]] Kode_staf(fk)[char[8]] Tanggal[VarChar[8]] Jumlah[Int[5]] Keterangan[VarChar[50]]

melakukan Dilakukan oleh

ditangani oleh menangani

menangani ditangani oleh

Gambar 4. ERD Physical Database Scheme Perancangan Antar Muka Page name : form log in Links from screen :Links to screen : form menu utama

Gambar 5. Form Login

dialami mengalami

menangani ditangani oleh

Kode_Penjualan(pk)[Char[8]] Kode_Pemesanan(fk)[Char[8]] Kode_Pelanggan(fk)[Char[8]] Kode_Staf(fk)[Char[8]]

Pelanggan Kode_Pelanggan(pk)[char[8]] Nama Pelanggan[VarChar[25]] Telp[VarChar[15]] Fax[VarChar[15]] Email[VarChar[25]] Alamat[VarChar[50]] Kota[VarChar[15]]

Dilakukan oleh

terdiri dari termasuk dalam

melakukan

Kode_PengembalianUnit(pk)[Char[8]] Kode_produk(fk)[Char[8]] Kode_staf(fk)[Char[8]] Kode_Penerimaan(fk)[Char[8]] Tanggal_kembali[Char[8]] Jumlah[int[5]] Keterangan[varChar[50]]

Kode_PenjualanProduk(pk) Kode_Penjualan(fk) Kode_Produk(fk)

dimiliki oleh

Kode_PemesananProduk(pk)[Char[8]] Kode_Pemesanan(fk)[Char[8]] Kode_Produk(fk)[Char[8]]

mengalami dialami oleh

mengalami dialami oleh

memiliki

menangani

ditangani oleh

Staf

44

Penyerahan

dialami Kode_Penyerahan_produk(pk)[Char [8]] Kode_Penyerahan(fk)[Char[8]] Kode_Produk(fk)[Char[8]]

Penjualan_Produk

PengembalianUnit

menangani

mengalami

Penyerahan_Produk

Pemesanan_Produk

Kode_Penerimaan(pk)[Char[8]] Kode_Staf(fk)[Char[8]] Tanggal penerimaan[VarChar[8]] Keterangan[VarChar[50]]

ditangani oleh

dialami mengalami dialami

dimiliki oleh memiiliki

memiliki

Penerimaan

dimiliki oleh

dimiliki oleh

terdiri dari

termasuk dalam

termasuk dalam terdiri dari memiliki

Kode_Produk(pk)[Char[8]] Kode_JenisProduk(fk)[Char[8]] Kode_Golongan(fk)[Char[8]] Nama Produk[VarChar[25]] Asal [VarChar[20]] Jumlah stok[Int[8]] Jenis bungkusan[VarChar[15]] Keterangan[VarChar[50]]

Mutasi

Kode_ mutasi( pk)[Char [ 8]] Jenis_ mutasi[ VarChar[20 ]] Jumlah [ int[5 ]] Keterangan[ VarChar[50 ]]

melakukan

Penerimaan_Produk Kode_PenerimaanProduk(pk)[Char[8]] Kode_Penerimaan(fk)[Char[8]] Kode_Produk(fk)[Char[8]]

Kode_mutasi(pk)[Char[8]] Jenis_mutasi[VarChar[20]] Jumlah[int[5]] Keterangan[VarChar[50]]

Kode Satuan( pk)[Char [ 8]] Nama Satuan[ VarChar[20 ]] Keterangan[ VarChar[50 ]]

Gambar 6. Form Menu Utama Deskripsi : 1) Untuk memasukkan detail dari profil yang akan diinput oleh pengguna, klik ‘Profil’ atau menekan tombol ‘P’ pada keyboard. 2) Untuk memasukkan detail dari produk yang akan diinput oleh pengguna, klik ‘Produk’ atau menekan tombol ‘R’ pada keyboard. 3) Untuk menampilkan detail laporan, klik ‘Laporan’ atau menekan tombol ‘L’ pada keyboard. 4) Untuk menampilkan bantuan, klik ‘Bantuan’ atau menekan tombol ‘B’ pada keyboard. 5) Untuk melihat peta letak, klik ‘Peta Letak’ atau menekan tombol ‘K’ pada keyboard 6) Untuk masuk kembali dengan username dan password yang berbeda atau keluar dari aplikasi, klik ‘Log Off’ atau menekan tombol ‘O’ pada keyboard. Page name Links from screen Links to screen

: form Produk : form Produk :-

Gambar 7. Form Produk Deskripsi: 1) Untuk mengisi data baru, klik ‘Data Baru’ atau menekan Alt+’D’ pada keyboard 2) Untuk menghapus data yang ada pada tabel, klik ‘Hapus’ atau menekan Alt+’H’ pada keyboard. 3) Untuk menambah data pada tabel, klik ‘Tambah’ atau menekan Alt+’T’ pada keyboard. 4) Untuk mengubah data yang ada ditabel, klik ‘Ubah’ atau menekan Alt+U pada keyboard. 5) Untuk menyimpan data yang sudah diubah, klik ‘Simpan’ atau menekan Alt+’S’ pada keyboard 6) Untuk membatalkan pengisian data baru atau pengubahan data, klik ‘Batal’ atau menekan Alt+’B’ pada keyboard. 7) Untuk mencari data yang berada dalam table, klik ‘Cari’ atau menekan Alt+’C’ pada keyboard. Pencarian berdasarkan kode produk, nama produk, kode golongan, kode jenis produk, jumlah stok dan keterangan. 8) Untuk menambah jenis produk, klik ‘Jenis Produk’. 9) Untuk mengkonversi produk kedalam satuan tertentu, klik ‘Konversi’. 10) Untuk keluar dari form produk, klik ‘Keluar’ atau menekan tombol Alt+‘K’ pada keyboard. Page name : form Daftar Persediaan Barang Links from screen : form Laporan Links to screen : -

V.

KESIMPULAN DAN SARAN

Kesimpulan Setelah menyelesaikan penelitian ini, dapat disimpulkan bahwa sistem informasi yang sudah dibangun oleh peneliti dapat membantu PT. PERTAMINA (Persero) UPms. VII Depot Bitung dalam mengontrol dan memanajemen serta menjaga data-data persediaan produk non-BBM pada perusahaan dengan menggunakan sistem manajemen basis data. Sistem yang dibangun juga membantu untuk meningkatkan proses penerimaan, pemesanan, penyerahan dan pengembalian untuk produk non-BBM menjadi lebih efisien dalam hal waktu dan keakuratan data yang diperoleh.

Saran Setelah melalui tahap demi tahap untuk menganalisa dan merancang Sistem Informasi Inventori ini, peneliti menyadari bahwa masih ada yang dapat dikembangkan untuk sistem ini ke arah yang lebih sempurna. Hal yang perlu dikembangkan selanjutnya yaitu: 1) Sistem Informasi Inventori dapat dikembangkan untuk penggunaan pada sistem jaringan. 2) Laporan Sistem Informasi Inventori dapat dikembangkan dalam bentuk grafik. 3) Dapat mengembangkan Sistem Informasi Inventori untuk informasi biaya produk serta proses penjualannya.

DAFTAR PUSTAKA Gambar 8. Form Persediaan Barang Deskripsi : 1) Untuk mencari data yang berada dalam table berdasarkan kategori pilihan dan tanggal, klik ‘Cari’ atau menekan Alt+’R’ pada keyboard. Pencarian berdasarkan golongan, jenis produk, merek, stok awal, stok akhir dan tanggal. 2) Untuk mencetak daftar persediaan barang, klik ‘Cetak’ atau menekan Alt+’C’ pada keyboard. 3) Untuk keluar dari form daftar persediaan barang, klik ‘Keluar’ atau menekan tombol Alt+‘K’ pada keyboard.

[1]. L, Witthen Jeffey, D, Bentley Lonnie and C, Dittman Kevin.System Analysis and Design Methods. New York : McGraw-Hill, 2004. [2]. Alter, Steven.Informastion System as Management Perspective. Singapore : Adilisson-Wesley, 1998. [3]. Chase and Jacob.Operation Management for Competitive Advantage. USA : McGraw-Hill, 2004. [4]. H, Bodnar George.Accounting Information System. New Jersey : Prentice Hall, 2001. [5]. L, Witthen Jeffey, D, Bentley Lonnie and C, Dittman Kevin.System Analysis and Design Methods. New York : McGraw-Hill, 2004. [6]. Jerry, FitsGerald, FitsGerald, Andra and Stallings, Warren D.Fundamentals of System Analyst. New Jersey : International Inc, 1981. 45

[7]. Jogiyanto, Hartono.Analisis dan Desain Sistem Informasi. Jakarta : ANDI OFFSET, 1999. [8]. Indrajit, Eko, Richardus and Djokopranoto, Richardus.Konsep Supply Chain. Jakarta : PT. Gramedia Widiasarana Indonesia, 2002. COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benar-benar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

46

ANALISIS DAN PERANCANGAN SISTEM INFORMASI RAWAT INAP (STUDI KASUS : RUMAH SAKIT IBU DAN ANAK BUAH HATI CIPUTAT) Yuni Sugiarti1, Nuryasin2, Nur Fitriani3 1,2

Dosen Jurusan Sistem Informasi Mahasiswa Jurusan Sistem Informasi Fakultas Sains dan Teknologi, Universitas UIN Sharif Hidayatullah Jakarta Telp : (0251) 823026 Fax : (0251) 8624025 1 yuniihsan2gmail.com, 2 [email protected] , 3 e-mail : [email protected] 3

Abstract - Mother and Child Hospital Buah Hati is a private institution that is related to the world of health. One of the roles of mother and child hospital betel Hatiyaitu provide health services for children, mothers and society in general. To smoothness patient data, inpatient room, which was in the hospital needed a system that could manage this information. The purpose of this research is to design awake patient data processing system that has been applied and integrated. Help in registering patients, to determine the status of inpatient rooms, the search process patient data and preparing reports. The research methodology used is the method of data collection (interviews, observation, literature) and the method of system development (RAD) Rapid Application Development. RAD consists of Scope definition, system analysis, system design, testing and implementation. Inpatient Information System is built using the programming language PHP 5.1 and MySQL database using version 5.0.16. Results are Inpatient Information System that integrates well. Keywords: Analysis, Design, Information Systems, Inpatient, RAD

I.

PENDAHULUAN

A. Latar Belakang Rumah sakit ibu dan anak Buah Hati merupakan sebuah lembaga swasta yang berhubungan dengan dunia kesehatan. Salah satu tugas dari rumah sakit ini adalah memberikan pelayanan kesehatan bagi anakanak, ibu-ibu pada khususnya dan masyarakat pada umumnya. Untuk kelancaraan pengelolaan pendataan pasien, kamar rawat inap, diperlukan suatu sistem yang dapat mengelola informasi-informasi tersebut. Permasalahan yang terjadi adalah dimana belum adanya sistem informasi yang terintegrasi, dalam melakukan pendaftaran pasien masih memerlukan sumber daya yang banyak, untuk mengetahui status kamar rawat inap yang sudah terisi atau belum masih secara manual yaitu dengan cara menelpon bagian keperawatan, selain itu proses pencarian data pasien membutuhkan waktu yang cukup lama yaitu dengan cara mencari nomor rekam medis pasien diantara tumpukan arsip rekam medis pasien lainnya dan untuk perincian biaya pasien rawat inap yaitu dengan cara memasukan satu persatu biaya- biaya pasien selama di rumah sakit, hal itu pula yang akan menghambat proses pembuatan laporan data pasien. Untuk

menjamin keakuratan data yang akan disajikan diperlukan suatu sistem pengolahan data yang berbasis komputer, dikarenakan data yang diolah jumlahnya banyak, maka hal ini perlu dilakukan supaya data tidak menumpuk dimana akan menyita waktu dan menguras tenaga dalam menyelesaikan pekerjaan tersebut. Berdasarkan uraian diatas, maka peneliti merasa perlu adanya aplikasi yang mampu memberikan informasi mengenai berapa kunjungan pasien yang di rawat inap. Dengan keterangan : (1) Tahun 2008 jumlah pasien rawat inap sebanyak 2407 pasien, (2) Tahun 2009 sebanyak 4529 pasien, (3) Tahun 2010 sebanyak 5707 pasien, (3) Tahun 2011 sebanyak 5990 pasien, (4) Tahun 2012 sebanyak 6125 pasien dan untuk rata-rata ratio pertumbuhan selama 5 tahun dari tahun 2008-2012 sebesar 25%. Oleh karena itu, salah satu pemecahannya adalah kami melakukan penelitian dengan judul “Analisis dan Perancangan Sistem Informasi Rawat Inap pada Rumah Sakit Ibu dan Anak Buah Hati Ciputat”. B. Tujuan Penelitian Tujuan dari penelitian yang kami lakukan adalah sebagai berikut :

47

1. 2. 3.

4.

Terciptanya sistem informasi yang terintegrasi. Mengurangi sumber daya manusia pada proses pendaftaran pasien. Memberikan kemudahan kepada pegawai rumah sakit untuk mengetahui kamar rawat inap yang sudah terisi atau belum. Pencarian data pasien akan lebih cepat dengan adanya sistem informasi yang terintegrasi.

C. Identifikasi Masalah Identifikasi masalah dari penelitian ini antara la 1. 2. 3.

4.

Belum adanya sistem informasi yang terintegrasi. Dalam pendaftaran masih membutuhkan sumberdaya yang banyak. Belum adanya sistem informasi mengenai kamar rawat inap yang sudah terisi atau belum. Pencarian data pasien membutuhkan waktu yang lama.

D. Metode Penelitian Metode yang dilakukan dalam Analisis dan Perancangan Sistem Informasi Rawat Inap pada Rumah Sakit Ibu dan Anak Buah HatiCiputat. ini adalah langkah yang digunakan ialah observasi, wawancara dan studi pustaka, sedangkan metode pengembangan sistem yang digunakan ialah model RAD yang terdiri dari requirements planning, workshop design dan implementation. Langkah lebih rincinya adalah dilakukan pengumpulan data. Metode pengumpulan data yang digunakan dalam penelitian ini adalah sebagai berikut :[12] a. Observasi Pengamatan langsung terhadap proses kerja di Rumah Sakit Ibu dan Anak Buah HatiCiputat. Mengetahui sejauh mana proses pelayanan SDM Rumah sakit terhadap pasien, pelayanan yang ada dapat membantu melayani pasien atau tidak. b. Wawancara menjadi kegiatan awal yang dilakukan untuk memperoleh informasi mengenai proses kerja yang terjadi di Rumah sakit. Peneliti mengadakan proses tanya jawab secara langsung dengan direktur dan karyawan rumah sakit. Hasil yang didapatkan ialah informasi tentang bagaimana proses bisnis dan rancangan sistem yang diinginkan oleh pihak rumah sakit Buah Hati. c. Dokumentasi yaitu mengumpulkan data dengan cara penelusuran dan pencatatan data, dokumen, arsip, maupun referensi yang relevan di rumah sakit Buah Hati.

48

II. KAJIAN LITERATUR A. Konsep Dasar Sistem Sistem adalah suatu jaringan kerja dari prosedurprosedur yang saling berhubungan, berkumpul bersama-sama untuk melakukan suatu kegiatan atau untuk menyelesaikan suatu sasaran tertentu. [4]. B. Database Management System (DBMS) Basis data (database) adalah suatu pengorganisasian sekumpulan data yang saling terhubung sehingga memudahkan aktivitas untuk memperoleh informasi. basis data dimaksudkan unutk mengatasi problem pada sistem yang memakai pendekatan berbasis berkas. DBMS adalah perangkat lunak sistem yang memungkinkan pada pemakai membuat, memelihara, mengontrol, dan mengakses basis data dengan cara yang praktis dan efisien. Database Management System (DBMS) adalah perangkat lunak komputer yang digunakan untuk membuat dan mengontrol sebuah database. [15]. C. XAMPP Kepanjangan dari XAMPP yaitu Apache, PHP, MySQL dan phpMyAdmin. XAMPP merupakan tool yang menyediakan paket perangkat lunak ke dalam satu buah paket. Dengan menginstal XAMPP maka tidak perlu lagi melakukan instalasi dan konfigurasi web server Apache, PHP dan MySQL secara manual. XAMPP akan menginstalasi dan mengkonfigurasikannya secara otomatis untuk anda atau auto konfigurasi. [9] D. Sistem Informasi Berbasis Web Sistem Informasi Berbasis Web adalah seperangkat komponen yang saling berhubungan yang berfungsi mengumpulkan, memproses, menyimpan, dan mendistribusikan informasi untuk mendukung pembuatan keputusan dan pengawasan dalam organisasi. Web atau WWW (Word Wide Web) adalah sebuah metode baru yang berjalan di dunia internet yang berkembang dengan cepat, dengan media ini dapat menciptakan puluhan bahkan ratusan aplikasi yang berjalan di bawah Web (under web). PHP adalah salah satu aplikasi program yang biasa digunakan dalam media internet saat ini. Databasenya adalah MySQL yaitu database server yang dapat berjalan di dalam media online sehingga database ini mudah dikelola oleh penggunanya. [13]. UML (Unified Modelling Language) adalah bahasa untuk memvisualkan, menentukan, membangun dan mendokumentasikan artefak sebuah sistem perangkat lunak. UML didefinisikan sebagai keluarga notasi grafis yang didukung oleh meta model tunggal, yang membantu pendeskripsian dan desain sistem perangkat lunak, khususnya sistem yang dibangun menggunakan pemograman berorientasi objek [13].

2.5 Pengertian Rawat Inap Rawat inap adalah pemeliharaan kesehatan rumah sakit dimana penderita tinggal/mondok sediktnya satu hari berdasarkan rujukan dari pelaksana pelayanan kesehatan lain. Pelayanan kesehatan perorangan yang meliputi observasi, diagnosa, pengobatan, keperawatan, rehabilitasi medik, dengan menginap di ruang rawat inap pada sarana kesehatan rumah sakit pemerintah dan swasta, serta puskesmas perawatan dan rumah bersalin, yang oleh karena penyakitnya penderita harus menginap [1].

Perencanaan Syarat-syarat

Mengidentifikasi Masalah, Peluang, dan Tujuan

Menentukan Syarat-Syarat Informasi Menganalisis Kebutuhan Sistem

Workshop Design

Perancangan Proses

III. KERANGKA BERFIKIR PENELITIAN

Activity Diagram

Analisis dan Perancangan Sistem rawat inap ini disusun melalui beberapa tahapan yang harus dilakukan. Adapun kerangka berpikir penelitian yang dilakukan pada penulisan laporan penelitian ini adalah sebagai berikut:

Usecase Diagram Sequence Diagram

Metode Pengembangan Sistem dengan RAD Perancangan Database Class Diagram Mapping /LRS Analisis Data Perancangan Infrastruktur dan arsitektur sistem

Normalisasi Spesifikasi Database

Perancangan Antarmuka

STD Form

Fase Implementasi

Mengembangkan dan Mendokumentasikan Perangkat Lunak

Menguji dan Mempertahankan Sistem

Gambar 1. Kerangka Penelitian

IV. e.

HASIL DAN PEMBAHASAN

Use Case Diagram Diagram yang dibuat terdiri dari dua aktor, yaitu guru dan admin. Diagram yang dibuat terdiri dari lima aktor, yaitu staff, dokter, perawat, admin.

49

f.

Class Diagram user

transaksi

+id_user +user_name +password +status +akses

master

entry data user

<> pendaftaran pasien rawat inap

+create() +update()

cetak entry data user

1

staff entry data karyawan

cari pasien

1

<>

karyawan cari kamar

cetak entry data karyawan entry data kamar

menjadi

mencatat

<> daftar pasien keluar

perawat Admin

*

cetak entry data kamar entry data layanan

registrasi

biaya obat dan alkes

<>

cetak entry data layanan entry data visit

+id_karyawan 1 +nama 1 +alamat 1 +jk +tempat_lahir +tgl_lahir 1 +no_tlp 1 +no_hp +agama 1 +jabatan +spesialisasi

+no_reg +nama +tgl_daftar +tgl_masuk +jam_masuk +keluhan

biaya layanan

Dokter

<>

1 +add() 1 +create() +delete()

biaya visit

cetak entry data visit kasir

1

pembayaran <>

entry data obat dan alkes cetak pembayaran

<>

1

* * 1 *

keluar

memberitahukan +no_keluar +tgl_keluar +jam_keluar +lama_inap

*

1 mendapatkan

kamar

cetak laporan

+kd_kamar +nama_kamar +harga_kamar +add() +create() +delete() +print()

biaya_layanan

* biaya_obat_alkes

+kd_biaya_layanan +tgl_layanan +jam_layanan

+kd_biaya_obat_alkes * +tgl_pemberian +jam_pemberian

+add() +create() +delete()

+add() +create() +delete() memiliki

<>

memberikan

mengecek

*

laporan per bulan

* bayar

melakukan

+add() +create() +delete()

cetak entry data obat dan alkes laporan

mencatat

+add() +create() +delete()

*

*

memiliki

mengisi 1

1 layanan

obat_alkes +kd_obat_alkes +nama_layanan +harga_layanan

menggunakan +kd_layanan +nama_layanan +harga_layanan

+add() +create() +delete() +print()

+add() +create() +delete() +print()

melakukan

Gambar 2. Usecase Diagram mengalami

Gambar 3. Class Diagram

50

mengalami

* biaya_visit +kd_biaya_visit * +tgl_visit +jam_visit +add() +create() +delete() * memiliki 1 visit +kd__visit +nama_visit +harga_visit +add() +create() +delete() +print()

+kd_bayar +tgl_bayar +jam_bayar +total_tagihan +total_bayar +sisa +status +add() +create() +delete() +print() *

g.

Mapping Cardinalitas user +id_user +id_karyawan +user_name +password +status +akses +add() +update() id_karyawan karyawan +id_karyawan +nama +alamat +jk +tempat_lahir +tgl_lahir +no_tlp +no_hp +agama +jabatan +spesialisasi

id_karyawan

registrasi +no_reg +id_karyawan +nama +tgl_daftar +tgl_masuk +jam_masuk +keluhan

+add() +create() +delete() id_karyawan

+add() +create() +delete()

+no_keluar +no_reg +id_karyawan +kd_kamar +tgl_keluar +jam_keluar +lama_inap

+kd_kamar +nama_kamar +harga_kamar +add() +create() +delete() +print()

bayar

no_reg

biaya_visit

biaya_obat_alkes

+kd_biaya_layanan +id_karyawan +no_reg +kd_layanan +tgl_layanan +jam_layanan

+kd_biaya_obat_alkes +id_karyawan +no_reg +kd_obat_alkes +tgl_pemberian +jam_pemberian

+kd_biaya_visit +id_karyawan +no_reg +kd_visit +tgl_visit +jam_visit

+add() +create() +delete()

+add() +create() +delete()

+add() +create() +delete()

+kd_layanan +nama_layanan +harga_layanan +add() +create() +delete() +print()

kd_visit

kd_obat_alkes

layanan

kd_kamar

id_karyawan

id_karyawan

kd_layanan

+add() +create() +delete()

kamar

id_karyawan

biaya_layanan

keluar no_reg

id_karyawan

obat_alkes

no_reg

+kd_obat_alkes +nama_obat_alkes +harga_obat_alkes +add() +create() +delete() +print()

+kd_bayar +id_karyawan +no_reg +tgl_bayar +jam_bayar +total_tagihan +total_bayar +sisa +status +add() +create() +delete() +print()

visit no_reg

+kd_visit +nama_visit +harga_visit

no_rm

3. Halaman Input Obat dan alkes

+add() +create() +delete() +print()

Gambar 4. Mapping Cardinalitas Diagram

V. IMPLEMENTASI 1. Halaman Index

4. Halaman Input Pendaftaran Rawat Inap

2. Halaman Input User

51

5. Halaman Input Biaya Obat dan Alkes

VI.

KESIMPULAN DAN SARAN

A. Kesimpulan Berdasarkan hasil analisis terhadap sistem yang telah berjalan, masalah yang dihadapi serta sistem yang diusulkan untuk mengatasi masalah tersebut, maka dapat disimpulkan sebagai berikut: 1. Sesuai dengan tujuan awal, sistem dapat mengatasi masalah-masalah dalam kegiataan proses pendaftaran rawat inap sampai dengan pembayaran sehingga lebih mudah dan cepat. 2. Mengefisiensi waktu dan mempermudah dalam gefisiensi waktu dan mempermudah dalam mengakses berbagai informasi seperti lebih mudah dalam mengetahui kamar yang masih kosong atau sudah terisi. 3. Penyimpanan data yang sudah terkomputerisasi mempermudah rumah sakit dalam proses penyimpanan, pencarian dan report data yang semua itu tersimpan dalam database yang menciptakaan keamanan data dan proses-proses pengolahan data sehingga data tersimpan rapi, jelas dan tidak hilang atau tercecer. B. Saran Saran yang akan diberikan untuk pengembangan lebih lanjut atas sistem yang dirancang adalah sebagai berikut: 1. Sistem ini perlunya terintegrasi dengan apotek. 2. Sistem ini perlunya terintegrasi pasien UGD. 3. Sistem ini perlunya membahas pasien rawat inap yang menggunakan status jaminan ASKES, ASKESKIN, dan JAMSOSTEK. 4. Diharapkan sistem ini dapat bermanfaat bagi instansi yang terkait dan bisa menjadi acuan bagi peneliti selanjutnya. DAFTAR PUSTAKA [1] Astaqauliyah, 2012. Pengertian dan Fungsi Rumahsakit.http://astaqauliyah.com/2012/05/12/ 52

pengertian-dan-fungsi-rumah-sakit/. Diakses 12 Mei 2012. [2] Hakim, Lukmanul. 150 Rahasia dan Trik Menguasai PHP. Jakarta: Elex Media Komputindo,2004. [3] Irwanto S.kom, MM. Perancangan Object Oriented Software dengan UML. Yogyakarta: Andi Yogyakarta, 2006. [4] Jogiyanto. Analisis dan Desain Sistem Informasi: Pendekatan Terstruktur Teori dan Praktek Aplikasi Bisnis, Edisi 2. Yogyakarta: Andi Yogyakarta, 2001. [5] Jogiyanto. Analisis & Desain Sistem Informasi: Pendekatan Terstruktur Teori dan Praktek Aplikasi Bisnis. Yogyakarta: Andi Yogyakarta, 2005. [6] Munawar. Pemodelan Visual dengan UML. Yogyakarta : Graha Ilmu, 2005. [7] Muninjaya A. A.2004. Manajemen Kesehatan. Jakarta: EGC. [8] Rasyad, Aminuddin. Metode Riset Pendidikian. Jakarta: Fakultas Tarbiyah, 2002. [9] Siswoutomo, Wiwit. PHP Enterprise. Jakarta: Elek Media Komputindo, 2008. [10] Fuadi, Taufik. PHP dan MySQL dengan Editor Dreamweaver MX. Yogyakarta: Graha Ilmu, 2007. [11] Turban, E. Rainer dan Potter. Introduction to Information Technology, 2nd Edition. USA: John Wiley and Sons Inc, 2003. [12] Sugiarti, Yuni. Metodologi Penelitian di Bidang Sistem Informasi dan Komputer. Buku Ajar Dikmenti Banten. 2010. [13] Sugiarti, Yuni. Hypertext Markup Language (HTML) Dikti Provinsi Banten. Buku Ajar. 2012 [14] Sugiarti, Yuni. Analisis dan Perancangan UML (Unified Modeling language] Generated VB.6. Graha Ilmu. 2013. [15] Whitten, Jeffery L., Bentley, Lonnie D,. Dittman, Kevin C. (2004). Metode Desain dan Analisis Sistem. Edisi 6th. Alih bahasa Yogyakarta : Andi, 2004. [16] Whitten, Jeffery, L. Bentley, Lonnie, D. Dittman, Kevin, C. Metode Desain dan Analisis Sistem, Edisi keenam. McGrawHill. Yogyakarta: Penerbit Andi Yogyakarta, 2005. [17] Witarto. Memahami Sistem Informasi. Bandung: Informatika, 2004. COPYRIGHT Dengan ini kami menyatakan bahwa jurnal ini benarbenar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

ANALISA DAN DESAIN SISTEM KEHADIRAN PEGAWAI PADA PUSAT PENELITIAN PERKEMBANGAN IPTEK LEMBAGA ILMU PENGETAHUAN INDONESIA Warkim1, Hafiz Novanda Ichwan2, Husnul Kamal Z3 1

Pusat Penelitian Perkembangan Iptek LIPI Gedung A PDII-LIPI, Jl. Jend. Gatot Subroto 10 Jakarta Selatan 12710 Email: [email protected] 2

Magister Ilmu Komputer, Universitas Budiluhur Jl. Ciledug Raya, Petukangan Utara, Jakarta Selatan 12260 e-mail: [email protected] 3

Pusat Instrumentasi Rekayasa Jl. Angkasa 1 No. 2 Kemayoran, Jakarta Pusat e-mail: [email protected]

Abstract - The use of ICT (Information and Communication Technology) in supporting the reform of the bureaucracy becomes a necessity. One of them is the development of applications attendance system. The system currently running at the Research Center for Development of Science and Technology (PAPPIPTEK) which is a working unit in LIPI already using finger print attendance management application. Finger print attendance management application is an application that can read data presence and absence of employees, from fingerprints. Finger print attendance management system built using Microsoft Access database, this database is only as a client. This study was conducted to increase the performance of the current system runs, into a Web-Based Attendance System. Making it easier for sub-section of personnel and informing management and facilitate employee attendance data in the filing of applications for permission and services online. This information system is developed by using methods SDLC (System Development Life Cycle) or better known as the Systems Development Life Cycle so that repairs and future development can be done, according to the needs. From the test results information system is built, it is known this system can provide advantages and benefits to stakeholders ie employees, staffing and Management Sub-section. PAPPIPTEK LIPI employees can access presence information systems, and the official application for permit application online, subpart personnel can perform perekapan employee attendance and tardiness for the calculation of the performance benefits and meal money easily and efficiently. As well as mengapprove Management can request permission from the employees, as well as monitoring employee attendance. This can all be done online stakeholders. Keyword: Web base, SDLC, attandance, finger print

I. PENDAHULUAN Lembaga Ilmu Pengetahuan Indonesia (LIPI) merupakan instansi pemerintah non departemen yang sedang berupaya meningkatkan layanan dengan memanfaatkan teknologi informasi dan komunikasi (TIK) untuk menunjang administrasi maupun kegiatan penelitian. Dalam upaya mendukung peningkatan penggunaan TIK di LIPI, Pusat Penelitian Perkembangan Iptek (PAPPIPTEK) yang merupakan satuan kerja di LIPI mencoba membangun suatu aplikasi sistem berupa aplikasi sistem informasi absensi pegawai yang berbasiskan web. Sistem informasi ini

sangat dibutuhkan untuk mendukung pelaksanaan pekerjaan di bagian Tata Usaha terutama Sub Bagian Kepegawaian dan Umum. Sistem Informasi Kehadiran Pegawai ini dibangun untuk melengkapi sistem yang sudah berjalan yaitu menggunakan aplikasi finger print attendance management. Aplikasi finger print attendance management merupakan aplikasi yang berfungsi dapat membaca data kehadiran dan ketidakhadiran pegawai dari alat finger print (sidik jari). Sistem finger print attendance 53

B.

management dibangun dengan menggunakan database Microsoft Access, dimana database ini hanya bersifat client. Karena itu, bagian Tata Usaha terutama pada Sub Bagian Kepegawaian dan Umum memerlukan suatu aplikasi yang berbasiskan web, agar informasi kehadiran dapat diakses oleh pegawai melalui jaringan lokal maupun internet. Sistem informasi kehadiran pegawai ini sangat dibutuhkan di instansi pemerintah dalam upaya untuk menunjang reformasi birokrasi di pemerintahan terutama pada satuan kerja PAPPIPTEK-LIPI. Maksud dibangunnya Sistem Kehadiran Pegawai ini adalah untuk memudahkan pegawai dalam mengakses data kehadiran serta pengajuan permohonan ijin dan dinas dapat dilakukan secara online. Sedangkan tujuannya adalah untuk membantu staf sub bagian kepegawaian dalam mengelola dan menginformasikan data kehadiran serta untuk memudahkan pegawai PAPPIPTEKLIPI dalam pengajuan ijin maupun pengajuan kedinasan.

III. METODOLOGI Menurut Dennis dkk[3], System Devolopment Life Cycle (SDLC) atau sering disebut, Siklus Hidup Pengembangan Sistem adalah, Proses memahami bagaimana Sistem Informasi (SI) bisa mendukung kebutuhan bisnis, dengan cara merancang sistem, membangunnya, dan memberikannya kepada pengguna. SDLC mempunyai 4 (empat) fase/tahapan: Planning, Analysis, Desain dan Implementasi. Planning adalah proses penting memahami mengapa sistem informasi ini perlu dibuat. Analisis, Tahapan menjawab pertanyaan tentang siapa yang akan menggunakan sistem, apa yang akan di kerjakan oleh sistem, di mana dan kapan akan digunakan. Disain, tahap memutuskan bagaimana sistem akan beroperasi. Tahap implementasi, tahap dimana sistem benar-benar dibangun. Dalam melaksanakan SDLC ini ada beberapa metodologi yang digunakan yakni Waterfall development, Parallel Development, Vmodel, Rapid Aplication Development (RAD), Agile Development[3].

II. LANDASAN TEORI A. Analisa Sistem Analisa permasalahan merupakan hal yang pertama dilakukan setelah mendapatkan spesifikasi kebutuhan pengguna. Analisa bertujuan untuk mendapatkan pemahaman secara keseluruhan tentang sistem yang akan dikembangkan berdasarkan masukan dari pengguna (pengembang, manajemen dan sebagainya). Hasil yang diharapkan dari analisa sistem ini adalah mendapatkan pemahaman sistem secara keseluruhan sebagai persiapan untuk menuju ke tahap perancangan sistem[5]. Menurut Mc Leod Analisa Sistem adalah suatu studi dari sistem yang telah ada dengan tujuan untuk merancang sistem yang baru atau memperbaiki kekurangan dari sistem yang telah ada[4]. Menurut Pressman: analisa sistem adalah kegiatan menemukan atau mengidentifikasikan masalah, mengevaluasi, membuat model serta membuat spesifikasi sistem[6].

Metodologi pengembangan sistem yang digunakan untuk membangun aplikasi sistem informasi kehadiran pada Pusat Penelitian Perkembangan Iptek ini yaitu menggunakan metode RAD (Rafid Aplication Development) yang diperkenalkan oleh konsultan komputer dan penulis James Martin yang mengacu pada pengembangan siklus hidup untuk memproduksi sistem dengan cepat tanpa mengorbankan mutu dari sistem tersebut.

Desain Sistem Desain sistem adalah sebuah teknik pemecahan masalah yang saling melengkapi (dengan analisis sistem) yang merangkai kembali bagian-bagian komponen menjadi sistem yang lengkap dengan sebuah perbaikan sistem. Desain sistem ini melibatkan penambahan, penghapusan, dan perubahan-perubahan bagian relatif pada sistem awalnya.

54

RAD adalah sekumpulan strategi, metodologi dan alat terintegrasi yang terdapat didalam suatu kerangka kerja yang disebut rekayasa informasi. Siklus hidup RAD menurut martin menunjukkan banyaknya upaya yang dikeluarkan oleh pengguna maupun spesialis informasi. Dalam hal siklus hidup RAD, pengguna memainkan peranan yang penting kecuali dalam tahap konstruksi. Logika yang mendasari dari metode siklus hidup dengan metode RAD bahwa semakin banyak keterlibatan pengguna khususnya pada tahap-tahap awal maka akan memungkinkan sistem dikembangkan dengan lebih cepat[4].(Gambar 1.)

C.

Analisis Kebutuhan Sistem Sebelum ke tahap pembahasan kebutuhan sistem, sebenarnya instansi satuan kerja PAPPIPTEK-LIPI sudah menjalankan proses rekapitulasi sistem tentang kehadiran pegawai, namun proses rekapitulasi kehadiran pegawai tersebut masih berjalan secara manual. Proses sistem kehadiran yang sudah berjalan tersebut seperti yang terlihat pada gambar 2 dibawah ini. PEGAWAI

FINGER PRINT

KEPEGAWAIAN

Gambar 1. Siklus Hidup Pengembangan Sistem RAD Melakukan absen datang dan pulang

Sumber: James Martin, Rapid Aplication Development, edisi pertama, 1991

Memproses absen pegawai Merekap Data Kehadiran Pegawai Melakukan absen ulang

N

Y

IV. A.

ANALISIS DAN PEMBAHASAN Analisis Sistem Berjalan

Berikut prosedur kehadiran pegawai yang sedang berjalan di PAPPIPTEK-LIPI: • Pegawai PAPPIPTEK-LIPI yang terdiri dari staf bagian tata usaha, staf bidang pengelolaan dan diseminasi hasil penelitian, peneliti dan manajemen setiap harinya melakukan absen baik absen masuk maupun absen pulang dengan menggunakan sistem sidik jari (finger print). • Pegawai yang ijin tidak masuk atau dikarenakan sakit, datang terlambat dan pulang sebelum waktunya harus mengisi formulir pengajuan ijin dengan disetujui oleh atasan masing-masing pegawai. • Pegawai yang melakukan perjalanan dinas terlebih dahulu mengisi formulir kedinasan yang ditandatangani oleh atasan langsung atau Kepala Satuan Kerja. • Bagian Kepegawaian setiap bulan membuat rekap kekurangan jam kerja pegawai untuk dipergunakan dalam perhitungan uang makan dan tunjangan kinerja. • Bagian Keuangan menerima rekap kehadiran serta kekurangan jam kerja setiap pegawai. B.

Analisis Dokumen

Setelah penulis mengetahui prosedur yang ada pada sistem kehadiran pegawai yang sedang berjalan ini, maka penulis dapat menyimpulkan dokumen apa saja yang digunakan dalam sistem ini. Berikut ini akan diuraikan beberapa dokumen yang terkait dengan permasalahan system kehadiran pegawai yang diajukan, di antaranya :

Mengirimkan Data Kehadiran Pegawai Via Email

Memproses absen pegawai Menerima Email Data Kehadiran

Gambar 2. Activity Diagram Proses Berjalan Absensi Pegawai

Analisis kebutuhan sistem kehadiran pegawai terdiri dari beberapa tahapan antara lain developing a vision, modeling use case dan establising the domain model.

A.

Developing a vision

Fitur yang terkait developing a vision di dalam Perancangan Sistem Informasi Kehadiran Pegawai yang akan dibangun antara lain: a. Sistem Informasi dapat diakses dimana saja selama terdapat jaringan internet; b. Sistem Informasi berbasiskan web yang memudahkan pengunjung untuk melakukan pemantauan terutama absensi per masing-masing pegawai; c. Sistem Informasi dapat menerima data pegawai yang terdaftar dan dapat diolah menjadi laporan absensi bulanan dan tahunan; d. Pengguna melakukan absensi datang dan pulang pada mesin absen sidik jari. e. Pengguna dapat melihat laporan absensi pada bulan yang sedang berjalan; 55

f.

g.

h.

i.

B.

Sistem dapat melihat laporan kehadiran pegawai per bulan dan tahunan serta dapat mencetak laporan; Sistem dapat mencetak formulir permohonan ijin yang sudah disetujui oleh atasan dan kepala satuan kerja; Sistem dapat mencetak formulir kedinasan yang sudah disetujui oleh atasan dan kepala satuan kerja; Sistem dapat berjalan dengan menggunakan browser apa saja.

o

o

o o

Modelling Use Case o

Berdasarkan fitur-fitur rancangan yang sudah dijelaskan pada tahapan sebelumnya, maka dapat dijelaskan usecase diagram dari rancangan sistem kehadiran pegawai ini adalah sebagai berikut:

o

o

fungsi data pegawai: merupakan data profil pegawai pada Pusat Penelitian Perkembangan Iptek yang terdaftar dalam sistem dan yang sedang aktif. fungsi data login: merupakan data login untuk masuk ke dalam sistem, data login ini salah satu isinya username dan password. fungsi data referensi: merupakan data pendukung yang terdapat dalam sistem. fungsi form ijin: merupakan bentuk formulir isian yang digunakan pada saat pegawai melakukan ijin (tidak masuk, terlambat, pulang sebelum waktunya dan sakit). fungsi form kedinasan: merupakan bentuk formulir yang digunakan jika pegawai akan melakukan tugas dalam rangka dinas baik dinas luar kota maupun dalam kota. fungsi melihat informasi: merupakan bentuk laporan atau informasi yang dihasilkan dari system. Informasi yang dihasilkan bersifat real time untuk data kehadiran jam datang dan jam pulang hari kerja, informasi perhitungan kekurangan jam kerja, informasi ijin pegawai dan informasi pegawai yang melakukan dinas dalam format periode bulanan dan harian. fungsi pengiriman data absen sidik jari: merupakan fungsi automatisasi dari sistem kerja pada mesin absen. Fungsi pengiriman data ini dalam format database microsoft acces yang sudah terinstal diserver. C.

1. Gambar 3. Use Case Diagram Sistem Kehadiran Pegawai

Dilihat dari gambar 3. diatas dapat dijelaskan sebagai berikut : a. Sistem yang diusulkan memiliki 5 (lima) aktor yang berhubungan dengan fungsi-fungsi sistem yaitu administrator, pegawai, manajemen (pimpinan), arsiparis (penomoran surat) dan mesin absensi. Administrator memiliki fungsi memanipulasi (tambah, ubah dan hapus) data pegawai, data login pegawai serta data referensi yang diperlukan sistem. Manajemen dan pegawai dapat memanipulasi data permohonan ijin dan kedinasan yang berkaitan dengan pegawai yang bersangkutan, sedangkan manajemen merupakan turunan dari pegawai. Untuk pegawai hanya dapat melihat data dan informasi masing-masing, sedangkan manajemen dapat melihat data informasi kehadiran pegawai yang dibawahinya. b. Sistem yang diusulkan memiliki 8 (delapan) fungsi antara lain: 56

Establising the Domain Model

Absensi Pegawai Deskripsi Proses

Process Business Rules/Policies Process Workflow

Pegawai melakukan absen menggunakan sistem absensi finger print.. Setiap pegawai harus melakukan absen saat masuk dan pulang kerja dengan menggunakan alat finger print yang tersedia. • Pegawai melakukan absen saat masuk dan pulang kerja menggunakan alat finger print. • Alat finger print akan memproses sidik jari pegawai, apabila sidik jari tidak terbaca oleh alat finger print, maka pegawai tersebut harus mencobanya sampai berhasil. Setelah berhasil alat finger print akan menyimpan data hasil absensi yang tercatat sebagai jam datang maupun jam pulang. • Hasil absensi pegawai akan langsung terhubung secara real time dengan server aplikasi kehadiran pegawai, sehingga setiap pegawai dapat melakukan pengecekan terhadap absensi melalui perangkat komputer/notebook/smartphone masing-masing pegawai yang terhubung dalam jaringan intranet atau internet. • Apabila adanya kegagalan absen (sidik jari tidak terbaca oleh finger print), pegawai dengan cepat melaporkan ke bagian kepegawaian untuk dimasukan secara manual ke dalam sistem aplikasi kehadiran pegawai.

GAP Analisis As-Is

To-Be

Proses absensi direkap bagian kepegawaian secara manual sehingga memerlukan waktu

Proses perhitungan rekapitulasi kehadiran pegawai semakin cepat dan akurat

Proposed Solutions Menampilkan data absensi terkini dan melakukan perhitungan kekurangan jam kerja yang berdasarkan data dari mesin absensi finger print. Uraian analisis proses aliran data dari system kehadiran pegawai di PAPPIPTEK-LIPI ini dapat dijelaskan seperti pada gambar dibawah ini.

Gambar 4. Proses aliran data Absensi Sistem Kehadiran Pegawai

57

D.

Analisa Kebutuhan Data

1.

Class Diagram Sistem Kehadiran Pegawai

Gambar 15. Sequence Diagram Sistem Kehadiran Pegawai

58

2.

Entity Relationship Diagram (ERD)

Gambar 16. Entity Relationship Diagram Sistem Kehadiran Pegawai

59

E.

Rancangan Tampilan

Rancangan sistem kehadiran pegawai pada Pusat Penelitian Perkembangan Iptek terdiri dari beberapa hak akses antara lain: hak akses sebagai pegawai, manajemen dan administrator. 1.

Rancangan Tampilan Menu Hak Akses sebagai Manajemen

Profil Pegawai

Manajemen Data

Ganti Password

Absen Hari Ini LOGIN

MENU Informasi

Penghitungan jam Kerja

Tidak Masuk Kerja

Datang Terlambat Formulir Ijin Pulang Sebelum Waktunya Transaksi Ijin Sakit Formulir Dinas

Tidak Masuk Kerja Daftar Pegawai Ijin Datang Terlambat

Daftar Pegawai Dinas

Pulang Sebelum Waktunya

Ijin Sakit

60

V.

Kesimpulan dan Saran B. A.

Kesimpulan

Sistem Informasi Kehadiran Pegawai ini dibuat dengan berbasiskan web dengan tujuan untuk membantu pekerjaan pada bagian kepegawaian terutama dalam kehadiran dan perhitungan kekurangan jam kerja serta sebagai media informasi kehadiran untuk para pegawai baik staf, peneliti maupun manajemen. Dari penjelasan pada bab-bab sebelumnya penulis dapat merangkum beberapa kesimpulan antara lain: 1.

2.

3.

4.

5.

Sistem Informasi Kehadiran Pegawai berbasis komputerisasi yang dirancang ini diharapkan dapat menggantikan proses pencatatan data kehadiran yang dilakukan secara manual dengan tujuan untuk meminimalisasi tingkat kesalahan dalam pencatatan data kehadiran pegawai. Sistem pencatatan data kehadiran pegawai bersumber dari mesin absensi (finger print) yang dikoneksikan ke dalam server jaringan intranet dan internet dimana data absensi dari finger print dikombinasikan dengan data pengisian formulir ijin dan kedinasan pegawai. Sistem Informasi Kehadiran Pegawai dapat mempermudah dan mempercepat proses data kehadiran sehingga dapat menghemat waktu dan lebih efisien karena semua proses dilakukan secara online. Dengan adanya Sistem Informasi Kehadiran Pegawai ini manajemen, staf dan peneliti dapat melihat data kehadiran serta perhitungan kekurangan jam kerja masing-masing berdasarkan periode harian dan bulanan serta manajemen dapat melihat kehadiran staf/peneliti yang dipimpinnya. Sistem Informasi Kehadiran Pegawai ini juga dapat melakukan proses persetujuan kehadiran pegawai dilakukan secara online baik itu proses persetujuan ijin maupun proses kedinasan.

Saran

Untuk kelancaran dalam penerapan rancangan Sistem Informasi Kehadiran Pegawai ini, penulis memberikan saran kepada pegawai maupun manajemen, antara lain: 1.

2.

3.

Instansi Pusat Penelitian Perkembangan Iptek agar membangun serta mengimplementasikan Sistem Informasi Kehadiran Pegawai berdasarkan dari analisa dan desain sistem yang telah dibuat. Instansi pengguna diharapkan menyediakan Sumber Daya Manusia bidang teknologi informasi untuk membangun dan mengembangkan aplikasi Sistem Informasi Kehadiran Pegawai yang berbasiskan web. Rancangan analisa dan desain sistem kehadiran pegawai ini belum mencakup proses ijin cuti pegawai, diharapkan untuk pengembangannya kedepannya ditambahkan formulir pengajuan dan perhitungan cuti.

Daftar Pustaka [1] -------------, “ Standard Operation Procedure Pusat Penelitian Perkembangan IptekLIPI”, Jakarta, 2012. [2] Al Fattah, Hanif, ”Analisis dan Perancangan Sistem Informasi untuk Keuunggulan Bersaing Perusahaan dan Organisasi Modern”, STMIK AMIKOM Yogyakarta, Andi, Yogyakarta, 2007. [3] Dennis, Wixom, Tegarden, “System Analysis & Design With UML Version 2.0 An Object Oriented Approach”, Third Edition, USA: John Wiley and Sons, Inc. 2009. [4] McLeod, Jr., Raymond; Schell, George P., “Management Information System” Edisi Kesepuluh, Salemba Empat, Jakarta, 2008. [5] Nugroho, Adi, “Analisis dan Perancangan Sistem Informasi dengan Metodologi Berorientasi Objek”, Informatika, Bandung, 2002.

61

[6] Roger S. Pressman, “Software Engineering” A Practitionar’s Approach McGraw-Hill International Edition, 6th Edition, 2001.

COPYRIGHT

62

Dengan ini kami menyatakan bahwa jurnal ini benar-benar hasil karya sendiri yang belum pernah diajukan sebagai jurnal atau karya ilmiah pada perguruan tinggi atau lembaga manapun. Penulis bertanggung jawab dalam menyalin (mereproduksi) gambar atau tabel dan citra yang diperoleh dari pihak lain dengan apresiasi (acknowledgement) yang benar.

SISTEM INFORMASI PELAYANAN IZIN MENDIRIKAN BANGUNAN DAN PERUNTUKAN PENGGUNAAN TANAH PADA BADAN PENANAMAN MODAL DAN PELAYANAN PERIZINAN KABUPATEN SUMEDANG Bayu Waspodo 1, Ahmad Nurul Fajar 2, Noor Hadi Prayitno 3 1,2,3

Jurusan Sistem Informasi Fakultas Sains dan Teknologi Universitas Islam Negeri Syarif Hidayatullah Jakarta Jl. Ir. H. Juanda No. 95 Ciputat, Jakarta Selatan Email : [email protected]

Abstract- Board of Investment and Licensing Services (BPMPP) needs the support of information systems to help reduce the existing problems, ie, the information for the license applicant as retrieval time permits, the fees and procedures for the registration request is still not informed directly and transparently so the public is difficult to knowing the position of the file request, the fees and the absence of a data connection between each part of the work unit. The aim of this study is to produce a design of information systems licensing services IMB and IPPT web-based service BPMPP used for the process of licensing services, monitor outcomes of activity license lasts and facilitate citizens Sumedang district and foreigners who want to make IMB and IPPT because it can be done with on line. System development method used is a Rapid Application Development (RAD) designing the notation of the Unified Modelling Language (UML) version 1.5 and using the programming language PHP version 5.2.2, for the database using MySQL version 5.1.37. Results from this study is the Service Information System IMB and IPPT-based Web is an information system that could become business solutions in the register, the transparency of the status of the request, inspection, calculation and determination of permits, issuance of license, information delivery, as well as the summary report that dynamic. Keywords: BPMPP, Licensing Services, E-Government, RAD, IMB, IPPT, Unified Modeling Language, Web

1. PENDAHULUAN A. Latar Belakang Perkembangan teknologi informasi dan komunikasi telah membawa pengaruh yang besar terutama bagi organisasi pemerintahan. Persaingan global menuntut adanya daya saing yang tinggi dalam dunia usaha dan investasi. Daya saing bisa dilihat pada ketersediaan infrastrukur, efisiensi birokasi, serta berbagai kebijakan yang lebih mendukung perbaikan dunia usaha dan investasi. Secara global, penggunaan teknologi informasi dan komunikasi dalam kehidupan masyarakat sudah menjadi kebutuhan utama dalam mengembangkan masyarakat informasi (information society) dan masyarakat berpengetahuan (knowledge society) (Suprawoto, 2007). Di negara berkembang, banyak pengambil kebijakan yakin bahwa pemerintahan yang bersih, berwibawa, dan transparan dapat diwujudkan melalui egovernment (Indrajit, 2002). Sebagai upaya pemerintah dalam perbaikan pelayanan perizinan, perizinan

dilakukan dengan penerbitan Permendagri Nomor 24 Tahun 2006 tentang Pedoman Penyelenggaraan Pelayanan Terpadu Satu Pintu (PPTSP), Permendagri ini mewajibkan pemerintah daerah melakukan kegiatan penyederhanaan sistem dan prosedur perizinan usaha, pembentukan lembaga pelayanan perizinan terpadu satu pintu di daerah, perbaikan sistem informasi, dan pelaksanaan monitoring proses pelayanan perizinan. Maka pemerintah daerah harus melakukan perbaikan serta dukungan sistem informasi. Dukungan sistem informasi dalam hal ini meliputi pembangunan sistem informasi, penyusunan basis data, dan penerapan sistem informasi yang terencana dalam bentuk elektronik komputer serta terintegrasi sehingga proses komunikasi antar bagian di dalam PPTSP bisa saling terhubung secara online dengan jaringan LAN ataupun WWW melalui pengaksesan website. Penyusunan sistem basis data sesuai dengan jenis data pada PPTSP, jenis data disajikan terbuka, jenis data untuk keperluan pengolahan

63

internal dan jenis data yang akan diolah menjadi laporan bagi kepala bagian PPTSP. Sesuai Perda Kab. Sumedang No. 8 Tahun 2008 tentang organisasi perangkat daerah Kab. Sumedang, Badan Penanaman Modal dan Pelayanan Perizinan (BPMPP) merupakan organisasi perangkat daerah yang bertugas melaksanakan pembinaan dan pengembangan di bidang penanaman modal dan pelayanan perizinan. Pembentukan BPMPP terkait dengan dukungan sistem informasi masih terdapat beberapa kendala atau permasalahan. Kendala tersebut antara lain koordinasi antar bagian masih belum optimal, sistem data elektronik belum ada, penelusuran dokumen perizinan belum ada, jaringan bank data (data administrasi, data teknis, dan data informasi publik) belum terkoneksi, dan kemudahan penyampaian informasi yang belum optimal dan belum uptodate. Izin Mendirikan Bangunan (IMB) merupakan salah satu yang paling utama dan banyak permohonannya, selain itu untuk mendampingi IMB maka diperlukan pula Izin Peruntukan Penggunaan Tanah (IPPT) karena IPPT merupakan izin yang berbentuk rekomendasi perencanaan sebagai salah satu persyaratan administratif untuk memperoleh IMB. B. Rumusan Masalah Ditinjau dari latar belakang di atas, maka dapat dirumuskan pokok permasalahan yang akan dikaji lebih lanjut dalam penelitian ini, yaitu: 1. Tidak adanya koneksi data di antara masing-masing bagian (petugas informasi, administrasi, pemrosesan, penomoran dan penyerahan, Kasubid, bendahara dan Kabid). 2. Sulit dalam mengetahui posisi suatu berkas permohonan (transparasi) berada pada tahap mana pengerjaannya. 3. Masyarakat masih sulit memperoleh informasi tata cara dan persyaratan pembuatan surat izin IMB maupun IPPT, serta pendaftaran atau pengurusan yang serba harus datang ke kantor. 4. Informasi bagi para pemohon izin (waktu pengambilan izin dan biaya retribusi) yang masih belum diinformasikan secara uptodate. Berdasarkan identifikasi permasalahan tersebut, maka perumusan yang akan dibahas didalam penelitian ini adalah: Bagaimana membuat rancang bangun Sistem Informasi Pelayanan Izin Mendirikan Bangunan dan Izin Peruntukan Penggunaan Tanah berbasis Web sesuai dengan prosedur perizinan di Badan 64

Penanaman Modal dan Pelayanan Perizinan kabupaten Sumedang? C. Batasan Masalah Berdasarkan perumusan masalah di atas, maka batasan masalah yang akan dibahas adalah: 1. Rancang bangun sistem informasi pelayanan IMB dan IPPT berbasis web di BPMPP Kab. Sumedang. 2. Rancang bangun ini hanya di dalam lingkup dinas BPMPP Kab. Sumedang pada bagian pelayanan perizinan, penelitian tidak melibatkan kinerja petugas survey lapangan dan tidak melibatkan dinas terkait lainnya seperti dinas Badan Perencanaan Pembangunan Daerah (BAPPEDA) dan Satuan Kerja Perangkat Daerah (SKPD). 3. Perancangan dan pembuatan fitur front office yaitu modul pendaftaran perizinan IMB dan IPPT beserta cetak kartu kendali, modul pendaftaran akun, modul validasi pembayaran, modul pemantauan status permohonan, modul informasi profil dinas BPMPP, modul berita dan modul penyampaian keluhan sedangkan fitur back office pada sistem ini adalah modul pendaftaran, pemeriksaan, penetapan, pembayaran, peninjauan berkas, penomoran SK, monitoring laporan rekapitulasi, dan pemberian informasi secara uptodate, cetak SK, cetak SKRD, tidak melakukan implementasi sistem, pengguna sistem ini dibagi menjadi beberapa level berdasarkan hak akses sesuai jabatan/tugasnya. 4. Penelitian menggunakan model pengembangan sistem RAD (Rapid Application Development) dari tahap awal perencanaan syarat, desain sistem, implementasi. 5. Perancangan pengembangan sistem menggunakan UML versi 1.5 dengan Tools perancangan yang digunakan adalah StarUML versi 5.0.2.1570. Perancangan aplikasi berbasis web dengan menggunakan bahasa pemrograman PHP versi 5.2.2 dan database menggunakan MySQL versi 5.1.37. D. Tujuan Penelitian Adapun tujuan yang ingin dicapai oleh penulis dari hasil penelitian ini adalah: Menghasilkan rancang bangun sistem informasi pelayanan izin mendirikan bangunan dan peruntukan penggunaan tanah berbasis web pada BPMPP serta memonitori aktivitas

pelayanan perizinan yang berlangsung serta memudahkan para pemohon izin (warga Kabupaten Sumedang) maupun warga asing yang ingin berinvestasi, karena dapat dilakukan dengan online. E. Manfaat Penelitian Dengan adanya penelitian ini penulis mendapatkan manfaat, diantaranya: 1. Menerapkan ilmu-ilmu yang diperoleh selama dalam masa perkuliahan. 2. Mempermudah dinas BPMPP khususnya bagian pelayanan perizinan dalam mengelola perizinan secara sistem informasi. 3. Proses berjalannya sistem dapat terkoordinasi dengan baik antar tiap-tiap bagian (pelayanan, pemeriksaan penetapan, bendahara, penomoran, dan peninjauan). 4. Mendukung terwujudnya good government dan good governance serta meningkatkan citra dan wibawa aparatur negara sebagai petugas pelaksana pelayanan jasa perizinan pada dinas BPMPP.

2. LANDASAN TEORI A. Konsep Dasar Sistem Informasi 1. Pengertian Sistem Sistem adalah suatu jaringan kerja dari prosedur-prosedur yang saling berhubungan, berkumpul bersama-sama untuk melakukan suatu kegiatan atau menyelesaikan suatu sasaran tertentu (Jogiyanto, 2008). Dari definisi tersebut, maka penulis menyimpulkan bahwa sistem adalah kumpulan elemen-elemen yang saling berhubungan serta berinteraksi satu dengan lainnya untuk mencapai suatu tujuan. Elemen-elemen yang dimaksud berupa suatu subsistem atau bagian-bagian dari suatu sistem yang mencangkup struktur organisasi, sumber daya manusia, produser kerja, sarana, dan prasana. Jadi sistem adalah suatu kumpulan atau himpunan dari unsur variabel-variabel yang saling terorganisasi, saling berinteraksi, dan saling bergantung satu sama lain untuk mencapai suatu tujuan akhir. 2.

Pengertian Informasi Menurut Jogiyanto (2005), informasi adalah data yang diolah menjadi bentuk yang lebih berguna dan lebih berarti bagi yang menerimanya. Informasi sebagai data yang telah diolah menjadi bentuk yang lebih berarti dan berguna bagi penerimanya untuk mengambil keputusan masa kini

maupun yang akan datang (Ladjamuddin, 2005). B. Konsep Dasar Rancang Bangun Rancang bangun adalah proses, cara dan pembuatan suatu objek dengan mengatur segala sesuatunya, sebelum bertindak atau merancang suatu objek yang dimulai sejak awal hingga akhir objek tersebut dibuat, sehingga dalam proses pembuatannya sesuai acuan sehingga tidak keluar dari proses ataupun aturan yang sudah disepakati serta untuk memperbaiki proses bisnis bagi perusahaan. C. Pengertian Pelayanan Perizinan Pelayanan administrasi Pemerintahan atau pelayanan perizinan dapat didefinisikan sebagai segala bentuk jasa pelayanan yang pada prinsipnya menjadi tanggung jawab dan dilaksanakan oleh Instansi Pemerintah di Pusat, di Daerah, dan di lingkungan BUMN atau BUMD, baik dalam rangka upaya pemenuhan kebutuhan masyarakat maupun dalam rangka pelaksanaan ketentuan peraturan perundang-undangan, yang bentuk produk pelayanannya adalah izin atau warkat (Ratminto dan Winarsih, 2005). D. Pengertian E-Government Menurut Mustopadidjaja (2003), e-gov, juga dapat dipahami sebagai penggunaan teknologi berdasarkan web (jaringan), komunikasi internet, dan dalam kasus tertentu merupakan aplikasi interkoneksi untuk memfasilitasi komunikasi dan memperluas akses ke dan atau dari pemberian layanan dan informasi pemerintah kepada penduduk, dunia usaha, pencari kerja, dan pemerintah lain, baik instansional maupun antar negara. Menurut Indrajit (2004) definisi e-Government adalah aplikasi teknologi informasi dan komunikasi dari agen pemerintah. E. Konsep Dasar UML Unified Modelling Language (UML) adalah salah satu alat bantu yang sangat handal dalam dunia pengembangan sistem yang berorientasi obyek. Hal ini di sebabkan karena UML menyediakan bahasa pemodelan visual yang memungkinkan bagi pengembang sistem untuk membuat cetak biru atas visi mereka dalam bentuk yang baku, mudah di mengerti, serta di lengkapi dengan mekanisme yang efektif untuk berbagi (sharing) dan mengkomunikasikan rancangan mereka dengan yang lain (Munawar, 2005).

65

66

F. Konsep Dasar RAD Rapid Application Development (RAD) yaitu suatu pendekatan berorientasi objek terhadap pengembangan sistem yang mencakup suatu metode pengembangan serta perangkatperangkat lunak (Kendall dan Kendall, 2008). Jika kebutuhan dipahami dengan baik, proses RAD memungkinkan tim pengembangan menciptakan “sistem fungsional yang utuh” dalam periode waktu yang sangat pendek (kirakira 45 sampai 90 hari). Model pengembangan ini melingkupi aktivitas-aktivitas sebagai berikut: 1. Fase Perencanaan Syarat (Requirement Planning) Pada fase ini, dilakukan analisis requirements yang dimulai dengan mengidentifikasi requirements. Requirements tersebut dikelompokkan menjadi functional dan non functional requirements. 2. Fase Workshop Desain RAD Tahap desain sistem adalah tahap setelah analisis sistem yang menentukan proses dan data yang diperlukan oleh sistem baru. Tujuan pada tahap desain adalah untuk memenuhi kebutuhan kepada para pemakai sistem mengenai gambaran yang jelas dan rancang bangun yang akan dibuat dan diimplementasikan. 3. Fase Implementation Tahap implementasi atau penerapan adalah tahap di mana desain sistem telah dibentuk menjadi suatu kode (program) yang siap untuk dioperasikan. Tahap ini bertujuan untuk melakukan uji coba terhadap aplikasi yang telah dibuat dan juga sebagai sarana pengolahan data dan penyajian informasi.

luas bangunan, harga dasar bangunan dan koefisien/faktor lantai bangunan.

G. Izin Mendirikan Bangunan Izin Mendirikan Bangunan di Kab. Sumedang ini berada dibawah payung hukum Peraturan Bupati Nomor 4 Tahun 2000 tentang Retribusi Izin Mendirikan Bangunan. Dalam bab 3 pasal 3 tentang objek dan subjek menyatakan bahwa Objek retribusi adalah pemberian Izin Mendirikan Bangunan dan subjek retribusi adalah orang atau badan hukum yang memperoleh Izin Mendirikan Bangunan. Tingkat penggunaan jasa diukur berdasarkan jenis bangunan, klasifikasi dan volume. Prinsip penetapan besarnya tariff retribusi berdasarkan pada bab 6 pasal 6, yaitu Prinsip penetapan tarif retribusi adalah untuk kegiatan administrasi, perencanaan Koefisien Dasar Bangunan (KDB), Koefisien Lantai Bangunan (KLB) dan Koefisien Ketinggian Bangunan (KTB). Struktur dan besarnya tarif retribusi diukur berdasarkan: jenis bangunan, jenis konstruksi bangunan dan pelaksanaan pembangunan dengan

J.

H. Izin Peruntukan Penggunaan Tanah Izin Peruntukkan Penggunaan Tanah di Kab. Sumedang ini berada dibawah payung hukum Peraturan Bupati Nomor 25 Tahun 2000 tentang Retribusi izin peruntukkan penggunaan tanah. Izin Peruntukan Penggunaan Tanah adalah izin perencanaan bagi penggunaan tanah yang didasarkan pada RUTR/RDTR. Izin Peruntukan Penggunaan Tanah merupakan salah satu persyaratan administratif untuk memperoleh Izin Mendirikan Bangunan. Izin Peruntukan Penggunaan Tanah sebagaimana dimaksud dalam Ayat (2) pasal ini berlaku untuk jangka waktu 1 tahun terhitung sejak tanggal ditetapkan sepanjang pemegang izin tidak memproses permohonan Izin Mendirikan Bangunan dan hanya dapat diperpanjang 1 (satu) kali berdasarkan permohonan yang bersangkutan. Permohonan Izin Peruntukan Penggunaan Tanah ditolak apabila tidak sesuai dengan persyaratan yang telah ditentukan atau lokasi yang dimohon dalam keadaan sengketa.

I.

Konsep Dasar DBMS DBMS merupakan suatu sistem perangkat lunak yang memungkinkan user (pengguna) untuk membuat, memelihara, mengontrol, dan mengakses database secara praktis dan efisien DBMS dapat digunakan untuk mengakomodasikan berbagai macam pemakai yang memiliki kebutuhan akses yang berbeda-beda (Kadir, 2003). Sms Gateway SMS Gateway adalah suatu sistem yang menjembatani antara handphone dengan sistem yang menjadi server dengan SMS sebagai informasinya. SMS Gateway tidak memerlukan koneksi internet manapun karena sifatnya memang bekerja sendirian (stand alone). SMS Gateway memerlukan satu atau beberapa buah terminal (Budicahyanto, 2003). K. Aplikasi Berbasis Web Web application dikenal sebagai aplikasi yang diakses melalui web browser dan melalui jaringan seperti internet atau intranet. Kemampuan untuk memperbarui dan memelihara aplikasi web tanpa harus mendistribusikan dan menginstal perangkat lunak pada ribuan computer klien merupakan keunggulan teknologi ini, selain juga untuk cross-platform compatibility (Turban et al., 2006).

L. Blackbox Testing Pada jenis pengujian ini, perangkat lunak diuji memenuhi persyaratan fungsional. Pengujian dilakukan dalam bentuk tertulis untuk memeriksa apakah aplikasi berjalan seperti yang diharapkan. Pengujian ini meliputi seberapa baik sistem melaksanakan fungsinya, termasuk perintah perintah pengguna, manipulasi data, jenis jenis fungsi, proses pengguna layar dan integrasi (Simarmata, 2010).

3. METODOLOGI PENELITIAN 3.1 Kerangka Penelitian

Gambar 3.1 Kerangka Penelitian 3.2 Metode Pengumpulan Data 3.2.1 Observasi Dengan teknik observasi ini, penulis menggali data dan informasi tentang proses bisnis yang berjalan di bidang pelayanan perizinan yang dilakukan dilakukan pada tanggal 01 April 2013 pada kantor Badan Penanaman Modal dan Pelayanan Perizinan Kabupaten (BPMPP) Sumedang Jl. Prabu Geusan Ulun No. Sumedang. Hasil yang dicapai adalah melihat proses bisnis yang terjadi, dan melihat segala kegiatan atau mencari data yang diperlukan untuk penelitian. 3.2.2 Wawancara Wawancara ini penulis lakukan dalam bentuk wawancara berstruktur, yaitu pertanyaan-pertanyaan akan mengarahkan jawaban berdasarkan pertanyaan yang dikemukakan. Penulis melakukan wawancara kepada pihak-pihak yang berhubungan dengan aplikasi yang akan dibuat. Hasil wawancara ini berguna untuk memperoleh

data yang diperlukan dalam pembangunan sistem. Berdasarkan wawancara dan pengamatan yang penulis lakukan, pengumpulan informasi tersebut mengenai: 1. Standar Operasional Prosedur kegiatan pelayanan perizinan. 2. Alur proses permohonan perizinan sampai terbitnya surat izin. 3. Interaksi antara antar unit kerja dalam kegiatan pembuatan surat izin. Hal ini memuat berbagai keluhan ketika menggunakan sistem yang sedang berjalan. 3.2.3 Studi Pustaka dan Litertur Metode studi pustaka dilakukan dengan membaca buku-buku yang berkaitan dengan materi penelitian. Buku-buku tersebut antara lain Systems Analysis and Design, UMl, Basis Data, Aplikasi berbasis web, Sistem Informasi Konsep dan Aplikasi, Konsep pelayanan perizinan, Smsgateway, Pengujian sistem. Dalam pengumpulan data, ada beberapa literature yang dapat dipelajari dari konsep yang berhubungan dengan topik dari penelitian ini, berikut bebrapa literatur tersebut: 1. “Sistem Informasi Pemesanan Jasa Perizinan Mendirikan Usaha dan Bangunan” 2. “Pelayanan Perizinan Mendirikan Bangunan Berbasis Web Dengan Notifikasi SMS Gateway” 3. “Implementasi Web-Services Pada Sistem Pelayanan Perijinan Terpadu Satu Atap di Pemerintah Kota Palu” 4. “Pengembangan Aplikasi Pelayanan Izin Mendirikan Bangunan” 5. “Pengembangan Sistem Informasi (Studi Kasus: IUJK Dinas Pekerjaan Umum Kota Sawahlunto” 3.3 Metode Pengembangan Sistem 3.3.1 Perencanaan Persyaratan (Requirements Planning) Dalam tahap ini, terdapat beberapa langkah yang dilakukan dalam mengidentifikasi tujuan dari sistem yang diusulkan, dan berorientasi pada pemecahan masalah bisnis. Dalam tahap ini, akan menguraikan beberapa hal, yaitu: 1. Analisis Sistem Berjalan menjelaskan proses bisnis yang dilakukan oleh pelayanan perizinan terpadu di BPMPP dalam melakukan pembuatan izin mendirikan bangunan dan peruntukan penggunaan tanah sebelum adanya

67

2.

3.

sistem informasi pelayanan perizinan IMB dan IPPT berbasis web. Analisis kebutuhan user dan sistem mengidentifikasi alur kerja dari kegiatan pelayanan perizinan yang ada pada sistem berjalan sehingga menghasilkan sistem usulan sebagai solusi bisnis dan tujuan sistem ini. Identifikasi sistem usulan menguraikan tentang beberapa usulan yang dapat membantu menyelesaikan permasalahan yang ada pada sistem yang berjalan.

3.3.2 Desain Workshop RAD Tahapan RAD workshop design yang penulis buat terbagi atas 3 (tiga) tahap, yaitu perancangan proses, perancangan database dan perancangan interface. Berikut ini merupakan diagram-diagram yang penulis buat pada fase RAD workshop design: 4. Merancang sistem dengan menggunakan Unified Modelling Language (UML), berikut adalah tahapannya: a. Desain Proses a) Membuat use case diagram b) Membuat activity diagaram c) Membuat sequence diagram d) Membuat statechart diagram b. Desain Database a) Membuat class diagram b) Membuat schema diagram c) Membuat matriks CRUD d) Membuat spesifikasi database 5. Desain Interface Dalam membuat Graphic User Interface (GUI) penulis merancang tampilan antarmuka menggunakan aplikasi balsamiq mockups sebagai tools untuk membuat desain interface, GUI ini yang akan digunakan sebagai tampilan dari sistem informasi pelayanan perizinan IMB dan IPPT berbasis web. 3.3.3 Implementasi Sistem (System Implementation) Berikut tahapan implementasi yang terkait dengan penelitian ini: 1. Melakukan pengkodean sistem informasi pelayanan IMB dan IPPT berbasis web dengan menggunakan bahasa pemrograman PHP versi 5.2.2 dan MySQL versi 5.1.3.7 untuk database. 2. Melakukan pengujian (testing) aplikasi dengan metode Black Box yang terfokus pada apakah unit program memenuhi kebutuhan (requirement) yang ditentukan dalam functional requirement. Pada 68

black box testing, cara pengujiannya hanya dilakukan dengan menjalankan atau mengeksekusi unit atau modul, kemudian diamati apakah hasil dari unit itu sesuai dengan proses bisnis yang diinginkan.

4. HASIL DAN PEMBAHASAN A.

Fase Perencanaan Syarat 3.A.1 Analisis Sistem Berjalan Berdasarkan hasil observasi dan wawancara yang dilakukan terhadap user yang terlibat, maka dapat dijelaskan sistem yang sedang berjalan saat ini pada bagian pelayanan perizinan dalam melakukan pembuatan surat izin mendirikan dan peruntukan penggunaan tanah adalah sebagai berikut: a) Pada sistem yang berjalan saat ini, ketika ada calon pemohon izin akan membuat perizinan maka harus datang ke kantor BPMPP menemui petugas Informasi untuk diberikan Informasi tentang syarat-syarat dan prosedur membuat izin, kemudian ke Petugas Pendaftaran untuk mengambil ataupun menyerahkan formulir perizinan beserta berkas persyaratan perizinan. b) Data pemohon perizinan kemudian diberikan ke bagian pemeriksaan untuk dilakukan pemeriksaan kelengkapan apabila tidak lengkap maka akan dikembalikan lagi ke Petugas Pendaftaran untuk diserahkan kepada pemohon agar melengkapi kekurangannya. c) Jika berkas lengkap maka diserahkan kepada tim teknis, tim teknis memeriksa berkas bersifat investasi atau non investasi jika investasi maka tim teknis akan melakukan survey lapangan kemudian diadakan expose jika non investasi maka tim teknis melakukan survey lapangan namun tidak dilakukan expose. d) Jika tim teknis telah selesai maka diserahkan kepada Kasubbid PU dan Perindag untuk persetujuan/cap basah dan parafisasi, setelah itu baru diserahkan kepada kepala badan pelayanan perizinan untuk di tandatangan dan disetujui, setelah itu diberikan kembali ke Petugas Pendaftaran yang nanti diberikan kepada pemohon izin, namun dalam hal ini pemohon izin tidak mengetahui waktu pengambilan surat izin, hanya

diberikan informasi di awal pada saat mendaftar yaitu 15-25 hari kerja. Sistem berjalan ini penulis gambarkan dengan rich picture yang ada dibawah ini: G a m b a r Gambar 4.2 Rich Picture Sistem Informasi Pelayanan IMB & IPPT Berbasis Web

4 . 1

B. R i R i c h

Fase Workshop Desain RAD

3.B.1

Use Case Diagram System Registrasi Akun

Login <> Bagian Pendaftaran

Logout Pilih Jenis Izin <>

P i

<>

<> Upload Berkas

Cetak Bukti Daftar

Cetak Kartu Kendali

Monitoring Status Pendaftaran

Pemohon

Kirim Informasi ditolak <>

<>

<>

cture Sistem Berjalan

Kelola Pendaftaran

Pendaftaran izin

<>

Kasubid

Peninjauan Berkas

<> Monitoring Rekapitulasi

Akses Forum

3.A.2 Analisis Kebutuhan User dan Sistem Analisis yang penulis gunakan untuk membuat kebutuhan user dan sistem ialah dengan analisis Performance, Information, Economic, Control, Efficiency, Services (PIECES). Dari hasil analisis PIECES diperoleh kelemahan dari sistem lama yang sedang digunakan, kemudian dari hal tersebut penulis memperoleh konsep untuk membuat kebutuhan-kebutuhan sistem yang dinamakan functional dan nonfunctional requirements.

Kabid Entry Data Hasil Pemeriksaan

Kirim Pesan

<>

Lihat Panduan

Lihat Berita <>

Petugas Informasi

Upload Bukti Pembayaran <>

<>

Komentar Berita

Manajemen Berita

Penolakan Permohonan

Penetapan Retribusi

<>

<>

Manajemen Data User

<>

Cetak SKRD Cetak Draft SK

Manajemen Jenis Izin

Entry Data Pembayaran

Bagian Pengendalian Pengawasan

Kirim Informasi ditolak

<> Cetak Nota Perhitungan

Sms Gateway

Entry nomor SK <>

Bendahara Kirim Informasi Izin selesai

Bagian Penomoran Penyerahan

Entry Data Penyerahan SK

Gambar 4.3 Use case Diagram Sistem Informasi Pelayanan IMB dan IPPT Berbasis Web

3.A.3 Identifikasi Sistem Usulan Dari masalah yang dihadapi pada sistem yang sedang berjalan dalam melakukan proses memberikan pelayanan izin mendirikan bangunan dan peruntukan penggunaan tanah serta dari hasil analisis PIECES diperoleh kebutuhan fungsional dan non fungsional antara pengguna dan sistem digambarkan pada rich picture.

69

3.B.2

Activity Diagram Bagian Pengawas & Pengendalian

Siperzin

Pilih Menu Penetapan Izin

Isi Form Penetapan

Menampilkan Menu Penetapa

Pilih "Data Pemohon"

Menampilkan Data Pemohon field Informasi Pemohon Tampil Data Informasi Pemohon Pilih "Tambah"

Menampilkan Field baru

Pilih "Batal"

Pilih "Hitung"

Mengkalkulasi Perhitungan Retri

Menyimpan Data

Tampil Informasi Retribusi

Menampilkan Informasi Retribu

Gambar 4.4 Activity Diagram Penetapan Retribusi

3.B.3

Sequence Diagram

/ : Bagian Pengendalian Pengawasan

/Halaman Penetepan Izin

/Form Penetapan

1 : Masuk ke Menu Penetapan() 2 : Pilih Form Penetapan()

3 : Tampil Form Penetapan 4 : Isi Data BAP() 5 : Kirim Data P

8 : Menampilka

Gambar 4.5 Sequence Diagram Penetapan Retribusi

70

3.B.4 Pilih menu

State Chart Diagram Aktivitas Perizinan

Pilih menu

Tampilan Data

entry/Pilih Salah Satu Jenis Perizinan

C.

Pemeriksaan

Fase Implementasi 1.

entry/Pilh Nomor Pendaftaran entry/Isi Form Pemeriksaan

Rancangan Layar

Pilih status Status Pemeriksaan entry/Pilih Status

Lengkap, Pilih menu Penetapan

Tidak Memenuhi Syarat, Pilih Menu Penolak

Penetapan

Penolakan

entry/Pilih Nomor Pendaftaran entry/Isi Form Penetapan

entry/Pilih Nomor Pendaftaran entry/Isi Tanggal Penolakan entry/Isi Nomor Penolakan

Total Biaya do/Tampil Hasil Kalkulasi

Nota Perhitungan

SKRD

Smsgateway

Simpan

entry/Cetak To PDF

do/Kirim Informasi Pe

Preview

entry/Cetak To PDF

Draft SK entry/Cetak to PDF

Gambar 4.6 Statechart diagram Pemeriksaan, Penetapan, Penolakan 3.B.5

Class Diagram

Gambar 4.11 Interface Halaman Utama

Gambar 4.7 Sistem Informasi Pelayanan IMB dan IPPT Berbasis Web Gambar 4.12 Interface Halaman Login 3.B.6

Schema Diagram

Gambar 4.13 Interface Pendaftaran Izin

Gambar 4.8 LRS Sistem Informasi Pelayanan IMB dan IPPT Berbasis Web

71

Gambar 4.18 Interface Monitoring Rekapitulasi Gambar 4.14 Interface Cetak Bukti Daftar

Gambar 4.19 Interface Manajemen Data User Gambar 4.15 Interface Login Backoffice

5. KESIMPULAN DAN SARAN 5.1

Gambar 4.16 Interface Halaman Utama Backoffice

Gambar 4.17 Interface Pemeriksaan

72

Simpulan Berdasarkan uraian dan pembahasan pada bab-bab sebelumnya, maka disimpulkan bahwa: 1. Penelitian ini menghasilkan sistem informasi pelayanan Izin Mendirikan Bangunan dan Peruntukan Penggunaan Tanah berbasis web sesuai dengan prosedur perizinan pada Badan Penanaman Modal dan Pelayanan Perizinan Kabupaten Sumedang khususnya bidang pelayanan perizinan yang dapat di akses oleh masyarakat Kabupaten Sumedang serta unit kerja pendaftaran, pemroses izin, kasubid, bendahara, penomoran dan penyerahan, kepala bidang. Penelitian ini juga sebagai solusi bisnis untuk dinas Badan Penanaman Modal dan Pelayanan Perizinan Kabupaten Sumedang karena sudah mengacu pada era egovernment. 2. Analisis dalam penelitian ini menggunakan metode pengembangan sistem Rapid Application Development (RAD) dari tahap perencanaan syarat, workshop desain sampai implementasi. Penelitian ini menggunakan metode pengujian blackbox untuk mengetahui seberapa besar adanya kesalahan pada sistem agar kesalahan-kesalahan yang ada bisa segera diperbaiki. 3. Sistem ini bisa menjadi solusi bagi pihak pelayanan perizinan dalam melakukan pendaftaran, pemeriksaan dan penerbitan izin

4.

5.

6.

karena proses pelayanan perizinan sudah saling terhubung antar masing-masing bagian kerja dengan adanya bank data yang bisa di akses oleh setiap unit kerja. Dengan adanya koneksi data disetiap unit kerja, maka terjadi peningkatan pelayanan yaitu posisi berkas permohonan IMB maupun IPPT bisa terlihat tahap pengerjaannya melalui status permohonan yang ada pada sistem informasi pelayanan IMB dan IPPT berbasis web ini. Masyarakat dengan mudah bisa mengetahui informasi tata cara pembuatan permohonan IMB dan IPPT, persyaratan yang diperlukan dalam permohonan IMB dan IPPT, bisa melakukan pendaftaran IMB atau IPPT secara online, serta pemohon izin bisa memantau status permohonan IMB atau IPPT melalui website. Pemohon bisa mendapatkan informasi mengenai biaya retribusi, konfirmasi bahwa permohonan IMB atau IPPT yang di ajukan di tolak dan waktu pengambilan permohonan IMB atau IPPT melalui fitur sms gateway sehingga informasi menjadi uptodate. 5.2

Saran Dalam pembangunan sistem ini tentu saja masih belum sempurna dan masih ada yang perlu ditambahkan atau dikembangkan lagi agar sistem ini menjadi lebih baik, yaitu: 1. Bagi peneliti selanjutnya bisa mengembangkan dengan berbagai metode pengembangan sistem lain dan bahasa pemrograman lainnya serta mengimplementasikannya sehingga bisa digunakan secara keseluruhan serta bisa mencangkup semua jenis izin dan terintegrasi dengan dinas terkait setempat. 2. Diharapkan pengembangan selanjutnya bisa dalam bentuk mobile, sehingga memudahkan pemohon dalam mengakses sistem terutama monitoring status berkas dan menyampaikan keluhan ataupun berdiskusi. Daftar Pustaka [1]. Ambler, S.W. 2005. A Manager’s Introduction to - The Rational Unified Process (RUP). http://www.ambysoft.com/downloads/man agersIntroToRUP.pdf. [Diakses pada tanggal 15 Januari 2015 jam 15.00]. [2]. Andri, K. 2003. Perancangan Sistem Informasi dan Aplikasinya. Jakarta: Gava Media. [3]. Hariyanto, B. 2004. Rekayasa Sistem berorientasi Objek. Bandung: Informatika.

[4]. Perbup No 4. 2000. Retribusi Izin Mendirikan Bangunan. Kabupaten Sumedang. [5]. Perbup No 25. 2000. Retribusi Izin Peruntukkan Penggunaan Tanah. Kabupaten Sumedang. [6]. Perbup No 35. 2009. Pelimpahan sebagian kewenangan penandatanganan perizinan dari Bupati kepada Kepala Badan Penanaman Modal dan Pelayanan Perizinan Kabupaten Sumedang serta proses persetujuan prinsip dan izin lokasi. Kabupaten Sumedang. [7]. Perda No 8. 2008. Organisasi Perangkat Daerah Kabupaten Sumedang. Kabupaten Sumedang. [8]. Perda No 5. 2011. Retribusi Perizinan Tertentu. Kabupaten Sumedang. [9]. Pressman, R.S. 2002. Rekaya Perangkat Lunak: Pendekatan Praktisi (Buku I). Andi: Yogyakarta. [10]. Putra, A. 2009. Peningkatan Sistem Pelayanan Dengan Penerapan Model Sistem Informasi Manajemen Satu Atap. [11]. Ratminto., dan Winarsih, A.S. 2006. Manajemen Pelayanan. Yogyakarta: Pustaka Pelajar. [12]. Simarmata, J. 2010. Rekayasa Perangkat Lunak. Yogyakarta: Andi. [13]. Suprawoto. 2007. Pelayanan Publik Melalui E-Government (Studi tentang Pelayanan KTP, e-Procurement dan PSBOnline di Kota Surabaya). Disertasi. Universitas Brawijaya, Malang. [14]. Sutabri, T. 2005. Sistem Informasi Manajemen. Yogyakarta: Andi [15]. Tarigan, D.E. 2013. Membangun SMS Gateway Berbasis Web dengan Codeigniter Cetakan kedua. Yogyakarta: Lokomedia. [16]. The World Bank Group. “A Definition of E-Government”. http://www.worldbank.org/publicsector/ego v/definition.htm, [online], [Diakses pada tanggal 15 Desember 2013]. [17]. Turban, E., Rainer, R.K., Potter, R.E. 2006. Introduction to Information Technology. Diterjemahkan oleh Kwary DA dan Sari DF. Jakarta: Salemba Infotek. [18]. Whitten, J.L., Bentley, L.D., Dittman, K.C. 2004. Metode Desain dan Analisis Sistem, edisi 6. Penerjemah: Tim Penerjemah Andi, editor. Yogyakarta: ANDI. Terjemahan dari: System Analysis and Design Methods. [19]. Wibowo, M.G.A. 2010. Sistem Informasi Pemesanan Jasa Perizinan Mendirikan Usaha dan Bangunan.

73